Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6568
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 17 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC17A1
Synonyms (NCBI Gene) Gene synonyms aliases	NAPI-1, NPT-1, NPT1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.2

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019052	hsa-miR-335-5p	Microarray	18185580
MIRT1353386	hsa-miR-1915	CLIP-seq
MIRT1353387	hsa-miR-2276	CLIP-seq
MIRT1353388	hsa-miR-302a	CLIP-seq
MIRT1353389	hsa-miR-302b	CLIP-seq
MIRT1353390	hsa-miR-302c	CLIP-seq
MIRT1353391	hsa-miR-302d	CLIP-seq
MIRT1353392	hsa-miR-302e	CLIP-seq
MIRT1353393	hsa-miR-3155	CLIP-seq
MIRT1353394	hsa-miR-3155b	CLIP-seq
MIRT1353395	hsa-miR-3194-3p	CLIP-seq
MIRT1353396	hsa-miR-372	CLIP-seq
MIRT1353397	hsa-miR-373	CLIP-seq
MIRT1353398	hsa-miR-3942-3p	CLIP-seq
MIRT1353399	hsa-miR-4666-5p	CLIP-seq
MIRT1353400	hsa-miR-4726-3p	CLIP-seq
MIRT1353401	hsa-miR-4772-3p	CLIP-seq
MIRT1353402	hsa-miR-484	CLIP-seq
MIRT1353403	hsa-miR-520a-3p	CLIP-seq
MIRT1353404	hsa-miR-520b	CLIP-seq
MIRT1353405	hsa-miR-520c-3p	CLIP-seq
MIRT1353406	hsa-miR-520d-3p	CLIP-seq
MIRT1353407	hsa-miR-520e	CLIP-seq
MIRT1353408	hsa-miR-656	CLIP-seq
MIRT1353409	hsa-miR-760	CLIP-seq
MIRT2459500	hsa-miR-138	CLIP-seq
MIRT2459501	hsa-miR-3607-5p	CLIP-seq
MIRT2459502	hsa-miR-4281	CLIP-seq
MIRT2459500	hsa-miR-138	CLIP-seq
MIRT2459501	hsa-miR-3607-5p	CLIP-seq
MIRT2459502	hsa-miR-4281	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005315	Function	Phosphate transmembrane transporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	8867793
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8288239
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006817	Process	Phosphate ion transport	TAS	8867793
GO:0015293	Function	Symporter activity	IEA
GO:0015747	Process	Urate transport	IBA
GO:0015747	Process	Urate transport	IMP	25252215, 27906618
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8288239
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	25252215, 27906618
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035435	Process	Phosphate ion transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0044341	Process	Sodium-dependent phosphate transport	IBA
GO:0044341	Process	Sodium-dependent phosphate transport	IDA	7826357
GO:0046415	Process	Urate metabolic process	IMP	19503597
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
182308	10929	ENSG00000124568

Protein

UniProt ID

Q14916

Protein name

Sodium-dependent phosphate transport protein 1 (Na(+)/PI cotransporter 1) (Na/Pi-4) (Renal Na(+)-dependent phosphate cotransporter 1) (Renal sodium-dependent phosphate transport protein 1) (Renal sodium-phosphate transport protein 1) (Sodium/phosphate cot

Protein function

Important for the resorption of phosphate by the kidney (PubMed:7826357). May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane (PubMed:7826357). Plays a role in urate transport in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	26 → 410	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney cortex, liver and brain but not in other tissues. {ECO:0000269|PubMed:7826357}.

Sequence

MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTS
TKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSV
LSLLIPPAAGIGVAWVVVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLL
GPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITS
SLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKEN
GFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSS
TFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI
LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL

Sequence length

467

Interactions

View interactions

	Reactome
			Organic anion transporters

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dental caries	Dental caries	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Diabetes Mellitus Type 1	Associate	37696853
Gout	Associate	22541845, 26290326, 38222853
Hyperuricemia	Associate	32375679, 38222853
Hypouricemia Renal 2	Associate	32375679
Insulin Resistance	Associate	32375679

SLC17A1 (solute carrier family 17 member 1)