Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	655
Gene name Gene Name - the full gene name approved by the HGNC.	Bone morphogenetic protein 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BMP7
Synonyms (NCBI Gene) Gene synonyms aliases	OP-1
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555815731	G>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(465)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002000	hsa-miR-22-3p	Luciferase reporter assay	19011694
MIRT002000	hsa-miR-22-3p	qRT-PCR, Luciferase reporter assay, Western blot	19011694
MIRT005882	hsa-miR-342-3p	Luciferase reporter assay, Northern blot, qRT-PCR	21172025
MIRT007204	hsa-miR-34a-5p	Western blot	23226240
MIRT023527	hsa-miR-1-3p	Microarray	18668037
MIRT052250	hsa-let-7b-5p	CLASH	23622248
MIRT437421	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24503542
MIRT002000	hsa-miR-22-3p	Luciferase reporter assay	24163368
MIRT002000	hsa-miR-22-3p	Luciferase reporter assay	24163368
MIRT660245	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT660244	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT660243	hsa-miR-326	HITS-CLIP	23824327
MIRT660242	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT660241	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT660240	hsa-miR-4667-5p	HITS-CLIP	23824327
MIRT660239	hsa-miR-4700-5p	HITS-CLIP	23824327
MIRT660238	hsa-miR-8089	HITS-CLIP	23824327
MIRT660237	hsa-miR-637	HITS-CLIP	23824327
MIRT660236	hsa-miR-7155-5p	HITS-CLIP	23824327
MIRT660235	hsa-miR-4284	HITS-CLIP	23824327
MIRT660234	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT660233	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT660232	hsa-miR-3170	HITS-CLIP	23824327
MIRT660231	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT732128	hsa-miR-137	Luciferase reporter assay, Western blot	26617798
MIRT732128	hsa-miR-137	Luciferase reporter assay, Western blot	26617798
MIRT437421	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	26610487
MIRT437421	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	26610487
MIRT437421	hsa-miR-542-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	31829291
MIRT660245	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT660244	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT660243	hsa-miR-326	HITS-CLIP	23824327
MIRT660242	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT660241	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT660240	hsa-miR-4667-5p	HITS-CLIP	23824327
MIRT660239	hsa-miR-4700-5p	HITS-CLIP	23824327
MIRT660238	hsa-miR-8089	HITS-CLIP	23824327
MIRT660237	hsa-miR-637	HITS-CLIP	23824327
MIRT660236	hsa-miR-7155-5p	HITS-CLIP	23824327
MIRT660235	hsa-miR-4284	HITS-CLIP	23824327
MIRT660234	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT660233	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT660232	hsa-miR-3170	HITS-CLIP	23824327
MIRT660231	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT755762	hsa-miR?370?3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	36765143
MIRT822488	hsa-miR-1	CLIP-seq
MIRT822489	hsa-miR-105	CLIP-seq
MIRT822490	hsa-miR-1178	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822492	hsa-miR-1228	CLIP-seq
MIRT822493	hsa-miR-1238	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822495	hsa-miR-1321	CLIP-seq
MIRT822496	hsa-miR-146a	CLIP-seq
MIRT822497	hsa-miR-146b-5p	CLIP-seq
MIRT822498	hsa-miR-194	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT822500	hsa-miR-1976	CLIP-seq
MIRT822501	hsa-miR-206	CLIP-seq
MIRT822502	hsa-miR-2110	CLIP-seq
MIRT822503	hsa-miR-24	CLIP-seq
MIRT822504	hsa-miR-2682	CLIP-seq
MIRT822505	hsa-miR-3150a-3p	CLIP-seq
MIRT822506	hsa-miR-3158-5p	CLIP-seq
MIRT822507	hsa-miR-3162-5p	CLIP-seq
MIRT822508	hsa-miR-3166	CLIP-seq
MIRT822509	hsa-miR-3180	CLIP-seq
MIRT822510	hsa-miR-3180-3p	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822512	hsa-miR-3196	CLIP-seq
MIRT822513	hsa-miR-3661	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822515	hsa-miR-3672	CLIP-seq
MIRT822516	hsa-miR-3673	CLIP-seq
MIRT822517	hsa-miR-370	CLIP-seq
MIRT822518	hsa-miR-3714	CLIP-seq
MIRT822519	hsa-miR-3907	CLIP-seq
MIRT822520	hsa-miR-3929	CLIP-seq
MIRT822521	hsa-miR-3944-5p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822523	hsa-miR-4252	CLIP-seq
MIRT822524	hsa-miR-4259	CLIP-seq
MIRT822525	hsa-miR-4268	CLIP-seq
MIRT822526	hsa-miR-4271	CLIP-seq
MIRT822527	hsa-miR-4279	CLIP-seq
MIRT822528	hsa-miR-4286	CLIP-seq
MIRT822529	hsa-miR-4329	CLIP-seq
MIRT822530	hsa-miR-4418	CLIP-seq
MIRT822531	hsa-miR-4419b	CLIP-seq
MIRT822532	hsa-miR-4434	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822534	hsa-miR-4448	CLIP-seq
MIRT822535	hsa-miR-4450	CLIP-seq
MIRT822536	hsa-miR-4478	CLIP-seq
MIRT822537	hsa-miR-449c	CLIP-seq
MIRT822538	hsa-miR-4516	CLIP-seq
MIRT822539	hsa-miR-4531	CLIP-seq
MIRT822540	hsa-miR-4633-5p	CLIP-seq
MIRT822541	hsa-miR-4649-5p	CLIP-seq
MIRT822542	hsa-miR-4691-5p	CLIP-seq
MIRT822543	hsa-miR-4699-3p	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT822547	hsa-miR-4719	CLIP-seq
MIRT822548	hsa-miR-4722-3p	CLIP-seq
MIRT822549	hsa-miR-4725-3p	CLIP-seq
MIRT822550	hsa-miR-4728-5p	CLIP-seq
MIRT822551	hsa-miR-4739	CLIP-seq
MIRT822552	hsa-miR-4743	CLIP-seq
MIRT822553	hsa-miR-4747-5p	CLIP-seq
MIRT822554	hsa-miR-4753-3p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT822556	hsa-miR-4756-5p	CLIP-seq
MIRT822557	hsa-miR-4760-3p	CLIP-seq
MIRT822558	hsa-miR-4771	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822560	hsa-miR-4789-5p	CLIP-seq
MIRT822561	hsa-miR-4796-5p	CLIP-seq
MIRT822562	hsa-miR-485-5p	CLIP-seq
MIRT822563	hsa-miR-493	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT822565	hsa-miR-509-3-5p	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822567	hsa-miR-509-5p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822569	hsa-miR-520a-5p	CLIP-seq
MIRT822570	hsa-miR-525-5p	CLIP-seq
MIRT822571	hsa-miR-548an	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822574	hsa-miR-561	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT822576	hsa-miR-613	CLIP-seq
MIRT822577	hsa-miR-617	CLIP-seq
MIRT822578	hsa-miR-631	CLIP-seq
MIRT822579	hsa-miR-645	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT822581	hsa-miR-767-3p	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822492	hsa-miR-1228	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT1943081	hsa-miR-1298	CLIP-seq
MIRT822495	hsa-miR-1321	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT1943082	hsa-miR-1973	CLIP-seq
MIRT822502	hsa-miR-2110	CLIP-seq
MIRT822504	hsa-miR-2682	CLIP-seq
MIRT1943083	hsa-miR-3065-5p	CLIP-seq
MIRT822505	hsa-miR-3150a-3p	CLIP-seq
MIRT822507	hsa-miR-3162-5p	CLIP-seq
MIRT1943084	hsa-miR-3182	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT1943085	hsa-miR-338-3p	CLIP-seq
MIRT1943086	hsa-miR-3607-3p	CLIP-seq
MIRT1943087	hsa-miR-3620	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822515	hsa-miR-3672	CLIP-seq
MIRT1943088	hsa-miR-3678-3p	CLIP-seq
MIRT1943089	hsa-miR-3686	CLIP-seq
MIRT822518	hsa-miR-3714	CLIP-seq
MIRT822519	hsa-miR-3907	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822526	hsa-miR-4271	CLIP-seq
MIRT1943090	hsa-miR-4290	CLIP-seq
MIRT822529	hsa-miR-4329	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT1943091	hsa-miR-4436b-5p	CLIP-seq
MIRT822535	hsa-miR-4450	CLIP-seq
MIRT822537	hsa-miR-449c	CLIP-seq
MIRT1943092	hsa-miR-4504	CLIP-seq
MIRT1943093	hsa-miR-450b-5p	CLIP-seq
MIRT1943094	hsa-miR-4530	CLIP-seq
MIRT1943095	hsa-miR-4652-3p	CLIP-seq
MIRT1943096	hsa-miR-4700-3p	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT822547	hsa-miR-4719	CLIP-seq
MIRT822549	hsa-miR-4725-3p	CLIP-seq
MIRT1943097	hsa-miR-4727-5p	CLIP-seq
MIRT822550	hsa-miR-4728-5p	CLIP-seq
MIRT1943098	hsa-miR-4729	CLIP-seq
MIRT822551	hsa-miR-4739	CLIP-seq
MIRT822553	hsa-miR-4747-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT822556	hsa-miR-4756-5p	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822563	hsa-miR-493	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT1943099	hsa-miR-514	CLIP-seq
MIRT1943100	hsa-miR-514b-3p	CLIP-seq
MIRT1943101	hsa-miR-517b	CLIP-seq
MIRT822571	hsa-miR-548an	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT1943102	hsa-miR-556-3p	CLIP-seq
MIRT822574	hsa-miR-561	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT822577	hsa-miR-617	CLIP-seq
MIRT1943103	hsa-miR-642b	CLIP-seq
MIRT1943104	hsa-miR-651	CLIP-seq
MIRT1943105	hsa-miR-664	CLIP-seq
MIRT1943106	hsa-miR-758	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT1943107	hsa-miR-873	CLIP-seq
MIRT822488	hsa-miR-1	CLIP-seq
MIRT822489	hsa-miR-105	CLIP-seq
MIRT2181843	hsa-miR-106a	CLIP-seq
MIRT2181844	hsa-miR-106b	CLIP-seq
MIRT2181845	hsa-miR-1202	CLIP-seq
MIRT2181846	hsa-miR-1224-3p	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822492	hsa-miR-1228	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT2181847	hsa-miR-1288	CLIP-seq
MIRT2181848	hsa-miR-1290	CLIP-seq
MIRT2181849	hsa-miR-1293	CLIP-seq
MIRT822495	hsa-miR-1321	CLIP-seq
MIRT2181850	hsa-miR-1322	CLIP-seq
MIRT2181851	hsa-miR-1343	CLIP-seq
MIRT2181852	hsa-miR-138	CLIP-seq
MIRT2181853	hsa-miR-150	CLIP-seq
MIRT2181854	hsa-miR-17	CLIP-seq
MIRT2181855	hsa-miR-1911	CLIP-seq
MIRT822498	hsa-miR-194	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT822500	hsa-miR-1976	CLIP-seq
MIRT2181856	hsa-miR-200b	CLIP-seq
MIRT2181857	hsa-miR-200c	CLIP-seq
MIRT822501	hsa-miR-206	CLIP-seq
MIRT2181858	hsa-miR-20a	CLIP-seq
MIRT2181859	hsa-miR-20b	CLIP-seq
MIRT822502	hsa-miR-2110	CLIP-seq
MIRT2181860	hsa-miR-216a	CLIP-seq
MIRT2181861	hsa-miR-216b	CLIP-seq
MIRT822503	hsa-miR-24	CLIP-seq
MIRT2181862	hsa-miR-25	CLIP-seq
MIRT822504	hsa-miR-2682	CLIP-seq
MIRT2181863	hsa-miR-302a	CLIP-seq
MIRT2181864	hsa-miR-302b	CLIP-seq
MIRT2181865	hsa-miR-302c	CLIP-seq
MIRT2181866	hsa-miR-302d	CLIP-seq
MIRT2181867	hsa-miR-302e	CLIP-seq
MIRT2181868	hsa-miR-3064-3p	CLIP-seq
MIRT2181869	hsa-miR-3127-3p	CLIP-seq
MIRT2181870	hsa-miR-3130-3p	CLIP-seq
MIRT822505	hsa-miR-3150a-3p	CLIP-seq
MIRT822507	hsa-miR-3162-5p	CLIP-seq
MIRT2181871	hsa-miR-3167	CLIP-seq
MIRT2181872	hsa-miR-3169	CLIP-seq
MIRT822509	hsa-miR-3180	CLIP-seq
MIRT822510	hsa-miR-3180-3p	CLIP-seq
MIRT1943084	hsa-miR-3182	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822512	hsa-miR-3196	CLIP-seq
MIRT2181873	hsa-miR-32	CLIP-seq
MIRT2181874	hsa-miR-329	CLIP-seq
MIRT1943085	hsa-miR-338-3p	CLIP-seq
MIRT2181875	hsa-miR-346	CLIP-seq
MIRT2181876	hsa-miR-3621	CLIP-seq
MIRT2181877	hsa-miR-362-3p	CLIP-seq
MIRT2181878	hsa-miR-363	CLIP-seq
MIRT2181879	hsa-miR-3646	CLIP-seq
MIRT2181880	hsa-miR-3656	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT2181881	hsa-miR-3667-3p	CLIP-seq
MIRT2181882	hsa-miR-367	CLIP-seq
MIRT822515	hsa-miR-3672	CLIP-seq
MIRT822516	hsa-miR-3673	CLIP-seq
MIRT1943088	hsa-miR-3678-3p	CLIP-seq
MIRT2181883	hsa-miR-3685	CLIP-seq
MIRT822518	hsa-miR-3714	CLIP-seq
MIRT2181884	hsa-miR-372	CLIP-seq
MIRT2181885	hsa-miR-373	CLIP-seq
MIRT2181886	hsa-miR-377	CLIP-seq
MIRT2181887	hsa-miR-384	CLIP-seq
MIRT822519	hsa-miR-3907	CLIP-seq
MIRT2181888	hsa-miR-3918	CLIP-seq
MIRT2181889	hsa-miR-3926	CLIP-seq
MIRT2181890	hsa-miR-3972	CLIP-seq
MIRT2181891	hsa-miR-3974	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822523	hsa-miR-4252	CLIP-seq
MIRT822524	hsa-miR-4259	CLIP-seq
MIRT822526	hsa-miR-4271	CLIP-seq
MIRT822527	hsa-miR-4279	CLIP-seq
MIRT2181892	hsa-miR-4288	CLIP-seq
MIRT2181893	hsa-miR-429	CLIP-seq
MIRT2181894	hsa-miR-4300	CLIP-seq
MIRT2181895	hsa-miR-4313	CLIP-seq
MIRT2181896	hsa-miR-432	CLIP-seq
MIRT822530	hsa-miR-4418	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822535	hsa-miR-4450	CLIP-seq
MIRT2181897	hsa-miR-4454	CLIP-seq
MIRT2181898	hsa-miR-4483	CLIP-seq
MIRT822537	hsa-miR-449c	CLIP-seq
MIRT2181899	hsa-miR-4505	CLIP-seq
MIRT1943093	hsa-miR-450b-5p	CLIP-seq
MIRT2181900	hsa-miR-4521	CLIP-seq
MIRT2181901	hsa-miR-4527	CLIP-seq
MIRT1943094	hsa-miR-4530	CLIP-seq
MIRT1943095	hsa-miR-4652-3p	CLIP-seq
MIRT2181902	hsa-miR-4677-3p	CLIP-seq
MIRT2181903	hsa-miR-4685-5p	CLIP-seq
MIRT822542	hsa-miR-4691-5p	CLIP-seq
MIRT822543	hsa-miR-4699-3p	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT2181904	hsa-miR-4708-3p	CLIP-seq
MIRT2181905	hsa-miR-4709-3p	CLIP-seq
MIRT2181906	hsa-miR-4711-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT822547	hsa-miR-4719	CLIP-seq
MIRT822548	hsa-miR-4722-3p	CLIP-seq
MIRT822549	hsa-miR-4725-3p	CLIP-seq
MIRT1943097	hsa-miR-4727-5p	CLIP-seq
MIRT2181907	hsa-miR-4728-3p	CLIP-seq
MIRT822550	hsa-miR-4728-5p	CLIP-seq
MIRT2181908	hsa-miR-4731-5p	CLIP-seq
MIRT2181909	hsa-miR-4733-5p	CLIP-seq
MIRT2181910	hsa-miR-4734	CLIP-seq
MIRT822551	hsa-miR-4739	CLIP-seq
MIRT822553	hsa-miR-4747-5p	CLIP-seq
MIRT822554	hsa-miR-4753-3p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT822556	hsa-miR-4756-5p	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822560	hsa-miR-4789-5p	CLIP-seq
MIRT2181911	hsa-miR-4793-5p	CLIP-seq
MIRT822562	hsa-miR-485-5p	CLIP-seq
MIRT822563	hsa-miR-493	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT822565	hsa-miR-509-3-5p	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822567	hsa-miR-509-5p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT2181912	hsa-miR-512-3p	CLIP-seq
MIRT2181913	hsa-miR-519d	CLIP-seq
MIRT2181914	hsa-miR-520a-3p	CLIP-seq
MIRT822569	hsa-miR-520a-5p	CLIP-seq
MIRT2181915	hsa-miR-520b	CLIP-seq
MIRT2181916	hsa-miR-520c-3p	CLIP-seq
MIRT2181917	hsa-miR-520d-3p	CLIP-seq
MIRT2181918	hsa-miR-520e	CLIP-seq
MIRT2181919	hsa-miR-520g	CLIP-seq
MIRT2181920	hsa-miR-520h	CLIP-seq
MIRT822570	hsa-miR-525-5p	CLIP-seq
MIRT2181921	hsa-miR-532-3p	CLIP-seq
MIRT2181922	hsa-miR-548a-3p	CLIP-seq
MIRT2181923	hsa-miR-548ae	CLIP-seq
MIRT2181924	hsa-miR-548aj	CLIP-seq
MIRT2181925	hsa-miR-548am	CLIP-seq
MIRT822571	hsa-miR-548an	CLIP-seq
MIRT2181926	hsa-miR-548e	CLIP-seq
MIRT2181927	hsa-miR-548f	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT2181928	hsa-miR-548x	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822574	hsa-miR-561	CLIP-seq
MIRT2181929	hsa-miR-579	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT822576	hsa-miR-613	CLIP-seq
MIRT822577	hsa-miR-617	CLIP-seq
MIRT2181930	hsa-miR-632	CLIP-seq
MIRT1943103	hsa-miR-642b	CLIP-seq
MIRT2181931	hsa-miR-654-3p	CLIP-seq
MIRT2181932	hsa-miR-662	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT822581	hsa-miR-767-3p	CLIP-seq
MIRT2181933	hsa-miR-876-5p	CLIP-seq
MIRT2181934	hsa-miR-920	CLIP-seq
MIRT2181935	hsa-miR-92a	CLIP-seq
MIRT2181936	hsa-miR-92b	CLIP-seq
MIRT2181937	hsa-miR-93	CLIP-seq
MIRT2181938	hsa-miR-938	CLIP-seq
MIRT2181849	hsa-miR-1293	CLIP-seq
MIRT2181881	hsa-miR-3667-3p	CLIP-seq
MIRT2181898	hsa-miR-4483	CLIP-seq
MIRT2181899	hsa-miR-4505	CLIP-seq
MIRT822542	hsa-miR-4691-5p	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT2181921	hsa-miR-532-3p	CLIP-seq
MIRT2181932	hsa-miR-662	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
HDAC2	Repression	17452977
LDB1	Unknown	17452977
LMO4	Activation	17452977
LMO4	Repression	17452977

Show/Hide all(93)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	TAS	2357959
GO:0001503	Process	Ossification	IEA
GO:0001656	Process	Metanephros development	IEP	18437684
GO:0001657	Process	Ureteric bud development	ISS
GO:0001707	Process	Mesoderm formation	IEA
GO:0001823	Process	Mesonephros development	IEP	18437684
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	14679171
GO:0003272	Process	Endocardial cushion formation	ISS
GO:0003344	Process	Pericardium morphogenesis	ISS
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9872992, 18184661, 18339631, 31515488, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	17977014
GO:0007411	Process	Axon guidance	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	28124060
GO:0010664	Process	Negative regulation of striated muscle cell apoptotic process	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IDA	19736306
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	21873635
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	9311995, 16049014, 17244894, 19736306
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	TAS	11580864
GO:0016358	Process	Dendrite development	TAS	11580864
GO:0021502	Process	Neural fold elevation formation	ISS
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IDA	18436533
GO:0030509	Process	BMP signaling pathway	IBA	21873635
GO:0030509	Process	BMP signaling pathway	IDA	16049014, 18436533
GO:0030509	Process	BMP signaling pathway	IMP	18326817
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030902	Process	Hindbrain development	ISS
GO:0031982	Component	Vesicle	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	ISS
GO:0032355	Process	Response to estradiol	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	15100360
GO:0034504	Process	Protein localization to nucleus	IDA	17244894
GO:0042326	Process	Negative regulation of phosphorylation	IDA	17244894
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043401	Process	Steroid hormone mediated signaling pathway	IMP	17244894
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	17244894
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IDA	16325379
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	18436533
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045786	Process	Negative regulation of cell cycle	IDA	11502704
GO:0045839	Process	Negative regulation of mitotic nuclear division	IDA	17244894
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	15100360, 17244894
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	14517293, 15100360, 16049014
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	27923061
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048738	Process	Cardiac muscle tissue development	ISS
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IDA	9693150
GO:0048812	Process	Neuron projection morphogenesis	IDA	16325379
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060272	Process	Embryonic skeletal joint morphogenesis	IEA
GO:0060393	Process	Regulation of pathway-restricted SMAD protein phosphorylation	IDA	16049014
GO:0060395	Process	SMAD protein signal transduction	IBA	21873635
GO:0060395	Process	SMAD protein signal transduction	IDA	17244894
GO:0060411	Process	Cardiac septum morphogenesis	ISS
GO:0060445	Process	Branching involved in salivary gland morphogenesis	IEA
GO:0060485	Process	Mesenchyme development	ISS
GO:0060548	Process	Negative regulation of cell death	IDA	12631064
GO:0060686	Process	Negative regulation of prostatic bud formation	IEA
GO:0060687	Process	Regulation of branching involved in prostate gland morphogenesis	IEA
GO:0060710	Process	Chorio-allantoic fusion	ISS
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0062023	Component	Collagen-containing extracellular matrix	IEA
GO:0070487	Process	Monocyte aggregation	IDA	15100360
GO:0070700	Function	BMP receptor binding	IBA	21873635
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0071773	Process	Cellular response to BMP stimulus	IMP	18326817
GO:0072040	Process	Negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis	IEA
GO:0072125	Process	Negative regulation of glomerular mesangial cell proliferation	IDA	17244894
GO:0072133	Process	Metanephric mesenchyme morphogenesis	IEA
GO:0072134	Process	Nephrogenic mesenchyme morphogenesis	IEA
GO:0072136	Process	Metanephric mesenchymal cell proliferation involved in metanephros development	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IMP	27923061
GO:1900006	Process	Positive regulation of dendrite development	IDA	11580864
GO:1900106	Process	Positive regulation of hyaluranon cable assembly	IDA	15100360
GO:1901223	Process	Negative regulation of NIK/NF-kappaB signaling	ISS
GO:1905069	Process	Allantois development	ISS
GO:1905312	Process	Positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA
GO:2000121	Process	Regulation of removal of superoxide radicals	ISS

MIM	HGNC	e!Ensembl
112267	1074	ENSG00000101144

Protein

UniProt ID

P18075

Protein name

Bone morphogenetic protein 7 (BMP-7) (Osteogenic protein 1) (OP-1) (Eptotermin alfa)

Protein function

Growth factor of the TGF-beta superfamily that plays important role in various biological processes, including embryogenesis, hematopoiesis, neurogenesis and skeletal morphogenesis (PubMed:31208997). Initiates the canonical BMP signaling cascade

PDB

1BMP , 1LX5 , 1LXI , 1M4U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00688	TGFb_propeptide	34 → 280	TGF-beta propeptide	Family
PF00019	TGF_beta	329 → 430	Transforming growth factor beta like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the kidney and bladder. Lower levels seen in the brain.

Sequence

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH

Sequence length

431

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction TGF-beta signaling pathway Axon guidance Hippo signaling pathway		Molecules associated with elastic fibres

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Congenital anomalies of kidney and urinary tract	Cakut	rs267606865, rs121908436, rs281875326, rs879255515, rs75462234, rs869320679, rs760905589, rs797045022, rs869320624, rs745597204, rs1114167358, rs1555879360, rs1577330805, rs1008555507	7590254
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	16367923
Multiple congenital anomalies	Multiple congenital anomalies	rs1057517732	17003840, 20506283, 24429398
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881, 19283074
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)	17975199

Show/Hide Unknown Diseases (7)

Disease term	Disease name	Evidence	References	Source
Unknown
Endometriosis	Endometriosis		21063030	ClinVar
Mental depression	Unipolar Depression, Major Depressive Disorder		21896235	ClinVar
Multiple Congenital Anomalies	multiple congenital anomalies/dysmorphic syndrome			GenCC
Hypospadias	hypospadias			GenCC
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Schizophrenia	Schizophrenia			GWAS
Dementia	Dementia			GWAS

Show/Hide Text Mining Associations (108)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	18496506, 21080950
Adenocarcinoma	Associate	24299561
Adenocarcinoma of Lung	Associate	34036102
Allanson Pantzar McLeod syndrome	Associate	22140272, 30027931
Alzheimer Disease	Associate	34556089
Arthritis Psoriatic	Associate	33250156
Arthritis Rheumatoid	Associate	26215036
Asthma	Associate	35731115
Atrial Fibrillation	Associate	34737791
Breast Neoplasms	Associate	15861517, 17895257, 21113658, 21935711, 22118688, 26431436, 27696331, 28407692, 34993493
Cakut	Associate	24429398
Carcinogenesis	Associate	26431436
Carcinoma Ductal	Associate	17895257
Carcinoma Hepatocellular	Associate	23179403, 24573607
Carcinoma Lobular	Stimulate	17895257
Carcinoma Non Small Cell Lung	Stimulate	25994008
Carcinoma Non Small Cell Lung	Associate	26617798
Carcinoma Ovarian Epithelial	Stimulate	34110955
Carcinoma Squamous Cell	Associate	24299561
Cardiomyopathy Dilated	Associate	33407844, 37840136
Cartilage Diseases	Associate	12919879, 18829350, 26123554
Cartilage Diseases	Inhibit	15094136
Cholangiocarcinoma	Associate	24969562
Chondrosarcoma	Associate	25390068
Cleft Palate	Associate	25662552
Colorectal Neoplasms	Associate	16769811, 25340937, 29986714, 38063988
Congenital contractural arachnodactyly	Inhibit	24969562
Craniosynostoses	Associate	35627201
Dental Caries	Associate	26662797
Diabetes Mellitus	Associate	25378054
Diabetic Nephropathies	Associate	25378054, 30988245, 32294702
Dyskinesias	Associate	25662552
Endometrial Neoplasms	Associate	24077349, 34360647
Endometriosis	Associate	37047609
Esophageal Squamous Cell Carcinoma	Associate	21913019
Fibrocartilaginous embolism	Associate	27075568, 30787052
Fibrosis	Inhibit	20093492, 26431436, 28407692, 34608249, 35671049
Fibrosis	Associate	23320068, 25378054, 37840136
Fractures Bone	Associate	25152406, 33034913
Glaucoma	Associate	12131877
Glaucoma Open Angle	Associate	19450457
Glioblastoma	Associate	26546412
Glioma	Associate	28925495, 39373720
Glomerulonephritis	Associate	28815607
Glomerulonephritis IGA	Inhibit	18496506
Graves Disease	Inhibit	35671049
Graves Ophthalmopathy	Inhibit	35671049
Heart Failure	Inhibit	37840136
Hypertension Pulmonary	Associate	12740218
Hypospadias	Associate	23727413
Hypoxia	Stimulate	29980690
Inflammation	Associate	19011694, 24877141, 26546412, 33250156
Inflammation	Stimulate	27095417
Inflammation	Inhibit	36830751
Intervertebral Disc Degeneration	Associate	25966142, 27075568
Kidney Diseases	Inhibit	12594282
Kidney Diseases	Associate	20093492, 21080950, 25378054
Lymphatic Metastasis	Associate	17522432, 21224856
Lymphoma Follicular	Associate	22473939
Lymphoma Mantle Cell	Associate	24069261
Melanoma	Stimulate	17522432
Melanoma	Associate	18560367, 19735263, 21673687
Mullerian aplasia	Associate	33434492, 35361250
Multiple Sclerosis	Associate	30553833
Muscular Dystrophy Duchenne	Associate	19453255
Neoplasm Invasiveness	Associate	21224856
Neoplasm Invasiveness	Stimulate	21913019
Neoplasm Metastasis	Stimulate	17522432
Neoplasm Metastasis	Associate	17895257, 25390068
Neoplasm Metastasis	Inhibit	19735263, 21935711, 26431436
Neoplasms	Associate	15861517, 17522432, 17895257, 18560367, 19283074, 21224856, 21913019, 21948155, 23179403, 24077349, 24573607, 26617798, 37688374
Neoplasms	Stimulate	25994008
Neoplasms Cystic Mucinous and Serous	Associate	37688374
Nephrosclerosis	Inhibit	21080950
Neuroblastoma	Associate	8227084
Neuroendocrine Tumors	Associate	39682758
Nonsyndromic Holoprosencephaly	Associate	35627201
Orofacial Cleft 1	Associate	25662552
Osteoarthritis	Inhibit	12919879, 26123554, 34608249
Osteoarthritis	Associate	18829350, 26778533, 36830751
Osteonecrosis	Associate	26590194
Osteoporotic Fractures	Associate	25152406
Osteosarcoma	Associate	11986346, 20225287, 33034913
Ovarian Neoplasms	Associate	37688374
Pancreatic Neoplasms	Associate	19056927
Pancreatic Neoplasms	Stimulate	23651239
Parkinson Disease	Associate	26889637
Primary Myelofibrosis	Stimulate	18349123
Prostatic Neoplasms	Associate	15861517, 19283074, 25552920, 25858146
Prostatic Neoplasms Castration Resistant	Associate	29453313
Psoriasis	Associate	33250156
Pulmonary Embolism	Associate	38259670
Renal Insufficiency Chronic	Inhibit	16686760
Respiratory Distress Syndrome Newborn	Associate	29077160
Sarcoma Alveolar Soft Part	Stimulate	33034913
Sarcoma Synovial	Stimulate	33034913
Simpson Golabi Behmel syndrome	Associate	30967578
Soft Tissue Injuries	Inhibit	12594282
Spondylitis Ankylosing	Associate	25518021
Status Asthmaticus	Associate	35731115
Stomach Neoplasms	Associate	16367923, 21224856
Tachycardia Atrioventricular Nodal Reentry	Associate	21224856
Thyroid Cancer Papillary	Associate	37603701
Urethritis	Associate	26663319
Urinary Bladder Neck Obstruction	Associate	28138557
Uterine Cervical Neoplasms	Associate	32323730
Uterine Cervicitis	Associate	37069588
Vascular Calcification	Associate	19453255

BMP7 (bone morphogenetic protein 7)