Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6547
Gene name	Solute carrier family 8 member A3
Gene symbol	SLC8A3
Synonyms (NCBI Gene)	NCX3
Chromosome	14
Chromosome location	14q24.2
Summary	This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions an

125

Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525949	hsa-miR-6868-5p	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525947	hsa-miR-298	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525947	hsa-miR-298	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	22012620
MIRT525954	hsa-miR-4257	PAR-CLIP	22012620
MIRT525953	hsa-miR-759	PAR-CLIP	22012620
MIRT525952	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525951	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT525950	hsa-miR-8073	PAR-CLIP	22012620
MIRT525949	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	22012620
MIRT525947	hsa-miR-298	PAR-CLIP	22012620
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT525945	hsa-miR-874-5p	PAR-CLIP	22012620
MIRT734620	hsa-miR-125a-3p	Luciferase reporter assayMicroarrayImmunofluorescenceImmunocytochemistry (ICC)	32163190
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525949	hsa-miR-6868-5p	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525947	hsa-miR-298	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525947	hsa-miR-298	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	22012620
MIRT525954	hsa-miR-4257	PAR-CLIP	22012620
MIRT525953	hsa-miR-759	PAR-CLIP	22012620
MIRT525952	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525951	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT525950	hsa-miR-8073	PAR-CLIP	22012620
MIRT525949	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	22012620
MIRT525947	hsa-miR-298	PAR-CLIP	22012620
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT525945	hsa-miR-874-5p	PAR-CLIP	22012620
MIRT1368462	hsa-miR-3148	CLIP-seq
MIRT1368463	hsa-miR-3652	CLIP-seq
MIRT1368464	hsa-miR-433	CLIP-seq
MIRT1368465	hsa-miR-4430	CLIP-seq
MIRT1368466	hsa-miR-4670-3p	CLIP-seq
MIRT1368467	hsa-miR-875-3p	CLIP-seq
MIRT1368468	hsa-miR-371b-3p	CLIP-seq
MIRT1368469	hsa-miR-4266	CLIP-seq
MIRT1368470	hsa-miR-4434	CLIP-seq
MIRT1368471	hsa-miR-4516	CLIP-seq
MIRT1368472	hsa-miR-4753-3p	CLIP-seq
MIRT1368473	hsa-miR-938	CLIP-seq
MIRT1368474	hsa-miR-942	CLIP-seq
MIRT2332626	hsa-miR-1273e	CLIP-seq
MIRT2332627	hsa-miR-1273f	CLIP-seq
MIRT2332628	hsa-miR-3126-5p	CLIP-seq
MIRT2332629	hsa-miR-3149	CLIP-seq
MIRT2332630	hsa-miR-3175	CLIP-seq
MIRT2332631	hsa-miR-3184	CLIP-seq
MIRT2332632	hsa-miR-342-5p	CLIP-seq
MIRT2332633	hsa-miR-345	CLIP-seq
MIRT2332634	hsa-miR-3679-3p	CLIP-seq
MIRT2332635	hsa-miR-3689d	CLIP-seq
MIRT2332636	hsa-miR-3978	CLIP-seq
MIRT2332637	hsa-miR-421	CLIP-seq
MIRT2332638	hsa-miR-423-5p	CLIP-seq
MIRT2332639	hsa-miR-4272	CLIP-seq
MIRT2332640	hsa-miR-4651	CLIP-seq
MIRT2332641	hsa-miR-4659a-3p	CLIP-seq
MIRT2332642	hsa-miR-4659b-3p	CLIP-seq
MIRT2332643	hsa-miR-4664-5p	CLIP-seq
MIRT2332644	hsa-miR-4716-3p	CLIP-seq
MIRT2332645	hsa-miR-4723-5p	CLIP-seq
MIRT2332646	hsa-miR-4775	CLIP-seq
MIRT2332647	hsa-miR-4803	CLIP-seq
MIRT2332648	hsa-miR-583	CLIP-seq
MIRT2332649	hsa-miR-608	CLIP-seq
MIRT2332650	hsa-miR-635	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
KCNIP3	Repression	16306395

108

Show/Hide all (108)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0005432	Function	Calcium:sodium antiporter activity	IBA
GO:0005432	Function	Calcium:sodium antiporter activity	IEA
GO:0005432	Function	Calcium:sodium antiporter activity	ISS
GO:0005432	Function	Calcium:sodium antiporter activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005516	Function	Calmodulin binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA	21959935
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	IEA
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	ISS
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0007154	Process	Cell communication	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0007612	Process	Learning	IEA
GO:0007612	Process	Learning	ISS
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0014819	Process	Regulation of skeletal muscle contraction	IEA
GO:0014819	Process	Regulation of skeletal muscle contraction	ISS
GO:0015297	Function	Antiporter activity	IEA
GO:0015368	Function	Calcium:monoatomic cation antiporter activity	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016528	Component	Sarcoplasm	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030001	Process	Metal ion transport	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031594	Component	Neuromuscular junction	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	ISS
GO:0042383	Component	Sarcolemma	IBA
GO:0042383	Component	Sarcolemma	IEA
GO:0042383	Component	Sarcolemma	ISS
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0043679	Component	Axon terminus	ISS
GO:0045202	Component	Synapse	IDA	21382638
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21959935
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	ISS
GO:0050808	Process	Synapse organization	IEA
GO:0050808	Process	Synapse organization	ISS
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IEA
GO:0051560	Process	Mitochondrial calcium ion homeostasis	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060402	Process	Calcium ion transport into cytosol	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0098703	Process	Calcium ion import across plasma membrane	IBA
GO:0098703	Process	Calcium ion import across plasma membrane	IEA
GO:0098794	Component	Postsynapse	IBA
GO:0098815	Process	Modulation of excitatory postsynaptic potential	IEA
GO:0098815	Process	Modulation of excitatory postsynaptic potential	ISS
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	ISS
GO:1903779	Process	Regulation of cardiac conduction	IEA
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1905060	Function	Calcium:monoatomic cation antiporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IEA
GO:1990034	Process	Calcium ion export across plasma membrane	IEA

MIM	HGNC	e!Ensembl
607991	11070	ENSG00000100678

P57103

Protein name

Sodium/calcium exchanger 3 (Na(+)/Ca(2+)-exchange protein 3) (Solute carrier family 8 member 3)

Protein function

Mediates the electrogenic exchange of Ca(2+) against Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes. Contributes to cellular Ca(2+) homeostasis

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01699	Na_Ca_ex	79 → 250	Sodium/calcium exchanger protein	Family
PF16494	Na_Ca_ex_C	253 → 380	C-terminal extension of sodium/calcium exchanger domain	Family
PF03160	Calx-beta	385 → 485	Calx-beta domain	Domain
PF03160	Calx-beta	519 → 619	Calx-beta domain	Domain
PF01699	Na_Ca_ex	753 → 918	Sodium/calcium exchanger protein	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is expressed in brain and skeletal muscle. Isoform 3 is expressed in excitable cells of brain, retina and skeletal muscle. Isoform 4 is expressed in skeletal muscle. {ECO:0000269|PubMed:15777725}.

Sequence

MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISALLLSPDVTDRKLTMEEEEAKRIAEMGKPVL
GEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESG
EERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFG
CTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW
SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLA
TTWLFVSLWLLYILFATLEAYCYIKGF

Sequence length

927

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Cardiac muscle contraction Adrenergic signaling in cardiomyocytes Apelin signaling pathway Olfactory transduction Endocrine and other factor-regulated calcium reabsorption Protein digestion and absorption Mineral absorption Hypertrophic cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy Dilated cardiomyopathy		Reduction of cytosolic Ca++ levels Sodium/Calcium exchangers Ion homeostasis

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Prostate cancer	Uncertain significance	rs76086886	RCV000149332

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	21382638, 26394601
Arthritis Rheumatoid	Associate	26983453
Colorectal Neoplasms	Associate	34127021
Medulloblastoma	Associate	28683437
Melanoma	Associate	32241263
Neoplasms	Associate	34127021, 40328013
Nerve Degeneration	Associate	30552797
Neuroblastoma	Associate	30552797
Ovarian Neoplasms	Associate	26584285
Reperfusion Injury	Associate	36253874
Tuberculosis Multidrug Resistant	Associate	34494553

SLC8A3 (solute carrier family 8 member A3)