IQCJ (IQ motif containing J)

Gene

• Entrez ID: 654502
• Gene name: IQ motif containing J
• Gene symbol: IQCJ
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q25.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1069671	hsa-miR-124	CLIP-seq
MIRT1069672	hsa-miR-1254	CLIP-seq
MIRT1069673	hsa-miR-130a	CLIP-seq
MIRT1069674	hsa-miR-130b	CLIP-seq
MIRT1069675	hsa-miR-142-3p	CLIP-seq
MIRT1069676	hsa-miR-301a	CLIP-seq
MIRT1069677	hsa-miR-301b	CLIP-seq
MIRT1069678	hsa-miR-3116	CLIP-seq
MIRT1069679	hsa-miR-3132	CLIP-seq
MIRT1069680	hsa-miR-361-5p	CLIP-seq
MIRT1069681	hsa-miR-3666	CLIP-seq
MIRT1069682	hsa-miR-3714	CLIP-seq
MIRT1069683	hsa-miR-3910	CLIP-seq
MIRT1069684	hsa-miR-3935	CLIP-seq
MIRT1069685	hsa-miR-4295	CLIP-seq
MIRT1069686	hsa-miR-4477b	CLIP-seq
MIRT1069687	hsa-miR-454	CLIP-seq
MIRT1069688	hsa-miR-4671-3p	CLIP-seq
MIRT1069689	hsa-miR-506	CLIP-seq
MIRT1069690	hsa-miR-661	CLIP-seq
MIRT1069691	hsa-miR-873	CLIP-seq
MIRT1069692	hsa-miR-1229	CLIP-seq
MIRT1069693	hsa-miR-1343	CLIP-seq
MIRT1069694	hsa-miR-146a	CLIP-seq
MIRT1069695	hsa-miR-146b-5p	CLIP-seq
MIRT1069679	hsa-miR-3132	CLIP-seq
MIRT1069696	hsa-miR-4789-3p	CLIP-seq
MIRT1069697	hsa-miR-589	CLIP-seq
MIRT2017155	hsa-miR-4420	CLIP-seq
MIRT2017156	hsa-miR-4684-5p	CLIP-seq
MIRT2017157	hsa-miR-4768-5p	CLIP-seq
MIRT2017158	hsa-miR-579	CLIP-seq

Other IDs

• MIM: 611622
• HGNC: 32406
• e!Ensembl: ENSG00000214216

Protein

• UniProt ID: Q1A5X6
• Protein name: IQ domain-containing protein J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15157	IQCJ-SCHIP1	4 → 158	Fusion protein IQCJ-SCHIP1 with IQ-like motif	Family

• Sequence:

  MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREY
  LQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDK
  LPGGRKVILLYLDQLARPTGFIHTLKEPQIERLGFLTLQ

• Sequence length: 159

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Osteoporosis	Associate	38484114	★☆☆☆☆ Found in Text Mining only