SLC6A13 (solute carrier family 6 member 13)

Gene

• Entrez ID: 6540
• Gene name: Solute carrier family 6 member 13
• Gene symbol: SLC6A13
• Synonyms (NCBI Gene): GAT-2, GAT2, GAT3
• Chromosome: 12
• Chromosome location: 12p13.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT526763	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT526762	hsa-miR-421	PAR-CLIP	22012620
MIRT526763	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT526762	hsa-miR-421	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005283	Function	Amino acid:sodium symporter activity	IDA	17502375
GO:0005283	Function	Amino acid:sodium symporter activity	IEA
GO:0005308	Function	Creatine transmembrane transporter activity	ISS
GO:0005332	Function	Gamma-aminobutyric acid:sodium:chloride symporter activity	IBA
GO:0005332	Function	Gamma-aminobutyric acid:sodium:chloride symporter activity	IDA	17502375, 22932902
GO:0005332	Function	Gamma-aminobutyric acid:sodium:chloride symporter activity	IEA
GO:0005332	Function	Gamma-aminobutyric acid:sodium:chloride symporter activity	TAS
GO:0005369	Function	Taurine:sodium symporter activity	IEA
GO:0005369	Function	Taurine:sodium symporter activity	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22932902
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006865	Process	Amino acid transport	IBA
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IDA	29175673
GO:0015171	Function	Amino acid transmembrane transporter activity	IDA	24842606
GO:0015185	Function	Gamma-aminobutyric acid transmembrane transporter activity	ISS
GO:0015293	Function	Symporter activity	IEA
GO:0015718	Process	Monocarboxylic acid transport	IDA	29175673
GO:0015734	Process	Taurine transmembrane transport	IEA
GO:0015734	Process	Taurine transmembrane transport	ISS
GO:0015881	Process	Creatine transmembrane transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0042995	Component	Cell projection	IBA
GO:0051936	Process	Gamma-aminobutyric acid reuptake	TAS
GO:0051939	Process	Gamma-aminobutyric acid import	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0089718	Process	Amino acid import across plasma membrane	IDA	24842606
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653

Other IDs

• MIM: 615097
• HGNC: 11046
• e!Ensembl: ENSG00000010379

Protein

• UniProt ID: Q9NSD5
• Protein name: Sodium- and chloride-dependent GABA transporter 2 (GAT-2) (Solute carrier family 6 member 13)
• Protein function: Mediates sodium- and chloride-dependent transport of gamma-aminobutyric acid (GABA) (PubMed:17502375, PubMed:22932902). Mediates transport of beta-alanine (PubMed:17502375). Can also mediate transport of taurine and hypotaurine (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00209	SNF	32 → 556	Sodium:neurotransmitter symporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, kidney, lung, liver and testis. {ECO:0000269|PubMed:11824941, ECO:0000269|PubMed:17502375}.
• Sequence:

  MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
  LCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQM
  IVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT
  SPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATF
  PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
  GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
  AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI
  LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNI
  EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
  SMVCIPAWSLYRLGTLKGPFRERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELES
  HC

• Sequence length: 602

Pathways

KEGG:

Synaptic vesicle cycle
GABAergic synapse

Reactome:

Na+/Cl- dependent neurotransmitter transporters
Reuptake of GABA