Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	653784
Gene name Gene Name - the full gene name approved by the HGNC.	Mitotic spindle organizing protein 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MZT2A
Synonyms (NCBI Gene) Gene synonyms aliases	FAM128A, MOZART2A
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q21.1

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043079	hsa-miR-324-5p	CLASH	23622248
MIRT1170806	hsa-miR-1252	CLIP-seq
MIRT1170807	hsa-miR-3173-3p	CLIP-seq
MIRT1170808	hsa-miR-3614-3p	CLIP-seq
MIRT1170809	hsa-miR-4330	CLIP-seq
MIRT1170810	hsa-miR-4795-3p	CLIP-seq
MIRT1170806	hsa-miR-1252	CLIP-seq
MIRT2049218	hsa-miR-3121-5p	CLIP-seq
MIRT2049219	hsa-miR-3144-5p	CLIP-seq
MIRT1170807	hsa-miR-3173-3p	CLIP-seq
MIRT2049220	hsa-miR-3191	CLIP-seq
MIRT1170808	hsa-miR-3614-3p	CLIP-seq
MIRT1170809	hsa-miR-4330	CLIP-seq
MIRT2049221	hsa-miR-4501	CLIP-seq
MIRT2049222	hsa-miR-4652-5p	CLIP-seq
MIRT2049223	hsa-miR-4667-5p	CLIP-seq
MIRT2049224	hsa-miR-4700-5p	CLIP-seq
MIRT2049225	hsa-miR-4731-5p	CLIP-seq
MIRT1170810	hsa-miR-4795-3p	CLIP-seq
MIRT2049226	hsa-miR-576-3p	CLIP-seq
MIRT1170806	hsa-miR-1252	CLIP-seq
MIRT1170807	hsa-miR-3173-3p	CLIP-seq
MIRT1170808	hsa-miR-3614-3p	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000931	Component	Gamma-tubulin ring complex	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA

MIM	HGNC	e!Ensembl
613449	33187	ENSG00000173272

Protein

UniProt ID

Q6P582

Protein name

Mitotic-spindle organizing protein 2A (Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A)

Protein function

Required for the recruitment and the assembly of the gamma-tubulin ring complex (gTuRC) at the centrosome (PubMed:20360068, PubMed:39321809). The gTuRC regulates the minus-end nucleation of alpha-beta tubulin heterodimers that grow into microtub

PDB

6X0V , 8RX1 , 9H9P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12926	MOZART2	8 → 96	Mitotic-spindle organizing gamma-tubulin ring associated	Family

Sequence

MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILV
DLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLA
LAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST

Sequence length

158

Interactions

View interactions

	Reactome
			Recruitment of mitotic centrosome proteins and complexes Recruitment of NuMA to mitotic centrosomes

MZT2A (mitotic spindle organizing protein 2A)