Gene Gene information from NCBI Gene database.
Entrez ID 653784
Gene name Mitotic spindle organizing protein 2A
Gene symbol MZT2A
Synonyms (NCBI Gene)
FAM128AMOZART2A
Chromosome 2
Chromosome location 2q21.1
miRNA miRNA information provided by mirtarbase database.
23
miRTarBase ID miRNA Experiments Reference
MIRT043079 hsa-miR-324-5p CLASH 23622248
MIRT1170806 hsa-miR-1252 CLIP-seq
MIRT1170807 hsa-miR-3173-3p CLIP-seq
MIRT1170808 hsa-miR-3614-3p CLIP-seq
MIRT1170809 hsa-miR-4330 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000931 Component Gamma-tubulin ring complex ISS
GO:0005515 Function Protein binding IPI 32814053
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613449 33187 ENSG00000173272
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6P582
Protein name Mitotic-spindle organizing protein 2A (Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A)
Protein function Required for the recruitment and the assembly of the gamma-tubulin ring complex (gTuRC) at the centrosome (PubMed:20360068, PubMed:39321809). The gTuRC regulates the minus-end nucleation of alpha-beta tubulin heterodimers that grow into microtub
PDB 6X0V , 8RX1 , 9H9P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12926 MOZART2 8 96 Mitotic-spindle organizing gamma-tubulin ring associated Family
Sequence
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILV
DLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVS
LPTSSVPETRGRDKGSAALGGVLA
LAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST
Sequence length 158
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Recruitment of mitotic centrosome proteins and complexes
Recruitment of NuMA to mitotic centrosomes