Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
653509
Gene name Gene Name - the full gene name approved by the HGNC.
Surfactant protein A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SFTPA1
Synonyms (NCBI Gene) Gene synonyms aliases
COLEC4, ILD1, PSAP, PSP-A, PSPA, SFTP1, SFTPA1B, SP-A, SP-A1, SP-A1 beta, SP-A1 delta, SP-A1 epsilon, SP-A1 gamma, SPA, SPA1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT546959 hsa-miR-19b-3p PAR-CLIP 21572407
MIRT546958 hsa-miR-19a-3p PAR-CLIP 21572407
MIRT546957 hsa-miR-301a-3p PAR-CLIP 21572407
MIRT546956 hsa-miR-454-3p PAR-CLIP 21572407
MIRT546955 hsa-miR-3666 PAR-CLIP 21572407
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 12040027
NKX2-1 Unknown 12040027
RELA Unknown 12040027
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005319 Function Lipid transporter activity TAS 2995821
GO:0005515 Function Protein binding IPI 10101009, 15845487
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005581 Component Collagen trimer IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
178630 10798 ENSG00000122852
Protein
UniProt ID Q8IWL2
Protein name Pulmonary surfactant-associated protein A1 (PSP-A) (PSPA) (SP-A) (SP-A1) (35 kDa pulmonary surfactant-associated protein) (Alveolar proteinosis protein) (Collectin-4)
Protein function In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 144 248 Lectin C-type domain Domain
Sequence
MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
Sequence length 248
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Phagosome
Pertussis
  Toll Like Receptor 4 (TLR4) Cascade
Toll Like Receptor TLR1:TLR2 Cascade
Signal regulatory protein family interactions
Surfactant metabolism
Regulation of TLR by endogenous ligand
Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5)
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Interstitial Lung Disease Interstitial lung disease 1 N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Lung Injury Associate 14742308
Adenocarcinoma Associate 24168624, 25514367, 9060993
Adenocarcinoma of Lung Associate 12698189, 32855221
Allergic Fungal Sinusitis Associate 26521790
Anemia Hemolytic Associate 2346784
Arthritis Psoriatic Associate 16489709
Arthritis Rheumatoid Stimulate 16489709
Asthma Associate 16884531, 17407567
Asthma Stimulate 23794464
Autoimmune Diseases Associate 24098648, 33267857