Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	652968
Gene name Gene Name - the full gene name approved by the HGNC.	Cytosolic arginine sensor for mTORC1 subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CASTOR1
Synonyms (NCBI Gene) Gene synonyms aliases	GATSL3
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.2

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 26972053, 28514442, 30956113, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	26972053
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0031669	Process	Cellular response to nutrient levels	IDA	36528027
GO:0034198	Process	Cellular response to amino acid starvation	IDA	26972053, 33594058
GO:0034198	Process	Cellular response to amino acid starvation	IDA	26972053, 33594058
GO:0034618	Function	Arginine binding	IBA
GO:0034618	Function	Arginine binding	IDA	26972053, 33594058
GO:0042802	Function	Identical protein binding	IDA	26972053
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 26972053, 32296183
GO:0061700	Component	GATOR2 complex	IDA	26972053
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:0140299	Function	Molecular sensor activity	IDA	26972053
GO:0140311	Function	Protein sequestering activity	IDA	33594058
GO:1903577	Process	Cellular response to L-arginine	IBA
GO:1903577	Process	Cellular response to L-arginine	IDA	26972053, 33594058
GO:1903577	Process	Cellular response to L-arginine	IMP	26972053
GO:1904262	Process	Negative regulation of TORC1 signaling	IBA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	26972053
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	26972053, 33594058
GO:1904262	Process	Negative regulation of TORC1 signaling	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IMP	26972053
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	36528027
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	26972053

MIM	HGNC	e!Ensembl
617034	34423	ENSG00000239282

Protein

UniProt ID

Q8WTX7

Protein name

Cytosolic arginine sensor for mTORC1 subunit 1 (Cellular arginine sensor for mTORC1 protein 1) (GATS-like protein 3)

Protein function

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway (PubMed:26972053, PubMed:27487210, PubMed:33594058). As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR sub

PDB

5GS9 , 5GT7 , 5GT8 , 5GV2 , 5I2C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18700	Castor1_N	9 → 69	Cytosolic arginine sensor for mTORC1 subunit 1 N-terminal domain	Domain
PF13840	ACT_7	71 → 139	ACT domain	Domain
PF13840	ACT_7	258 → 322	ACT domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000303|PubMed:26972053}.

Sequence

MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT
DFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP
QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV
MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST
FNFDHALVPEDGIGSVIEVLQRRQEGLAS

Sequence length

329

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway		Amino acids regulate mTORC1

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinogenesis	Associate	31305263
Neoplasms	Associate	31305263

CASTOR1 (cytosolic arginine sensor for mTORC1 subunit 1)