Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	652968
Gene name	Cytosolic arginine sensor for mTORC1 subunit 1
Gene symbol	CASTOR1
Synonyms (NCBI Gene)	GATSL3
Chromosome	22
Chromosome location	22q12.2

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 26972053, 28514442, 30956113, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	26972053
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0031669	Process	Cellular response to nutrient levels	IDA	36528027
GO:0034198	Process	Cellular response to amino acid starvation	IDA	26972053, 33594058
GO:0034198	Process	Cellular response to amino acid starvation	IDA	26972053, 33594058
GO:0034618	Function	Arginine binding	IBA
GO:0034618	Function	Arginine binding	IDA	26972053, 33594058
GO:0042802	Function	Identical protein binding	IDA	26972053
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 26972053, 32296183
GO:0061700	Component	GATOR2 complex	IDA	26972053
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:0140299	Function	Molecular sensor activity	IDA	26972053
GO:0140311	Function	Protein sequestering activity	IDA	33594058
GO:1903577	Process	Cellular response to L-arginine	IBA
GO:1903577	Process	Cellular response to L-arginine	IDA	26972053, 33594058
GO:1903577	Process	Cellular response to L-arginine	IMP	26972053
GO:1904262	Process	Negative regulation of TORC1 signaling	IBA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	26972053
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	26972053, 33594058
GO:1904262	Process	Negative regulation of TORC1 signaling	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IMP	26972053
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	36528027
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	26972053

MIM	HGNC	e!Ensembl
617034	34423	ENSG00000239282

Q8WTX7

Protein name

Cytosolic arginine sensor for mTORC1 subunit 1 (Cellular arginine sensor for mTORC1 protein 1) (GATS-like protein 3)

Protein function

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway (PubMed:26972053, PubMed:27487210, PubMed:33594058). As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR sub

PDB

5GS9 , 5GT7 , 5GT8 , 5GV2 , 5I2C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18700	Castor1_N	9 → 69	Cytosolic arginine sensor for mTORC1 subunit 1 N-terminal domain	Domain
PF13840	ACT_7	71 → 139	ACT domain	Domain
PF13840	ACT_7	258 → 322	ACT domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000303|PubMed:26972053}.

Sequence

MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT
DFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP
QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV
MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST
FNFDHALVPEDGIGSVIEVLQRRQEGLAS

Sequence length

329

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway		Amino acids regulate mTORC1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	31305263	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	31305263	★★★★★ ★☆☆☆☆ Found in Text Mining only

CASTOR1 (cytosolic arginine sensor for mTORC1 subunit 1)