Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
652968
Gene name Gene Name - the full gene name approved by the HGNC.
Cytosolic arginine sensor for mTORC1 subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CASTOR1
Synonyms (NCBI Gene) Gene synonyms aliases
GATSL3
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q12.2
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 26972053, 28514442, 30956113, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol IDA 26972053
GO:0005829 Component Cytosol IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617034 34423 ENSG00000239282
Protein
UniProt ID Q8WTX7
Protein name Cytosolic arginine sensor for mTORC1 subunit 1 (Cellular arginine sensor for mTORC1 protein 1) (GATS-like protein 3)
Protein function Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway (PubMed:26972053, PubMed:27487210, PubMed:33594058). As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR sub
PDB 5GS9 , 5GT7 , 5GT8 , 5GV2 , 5I2C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18700 Castor1_N 9 69 Cytosolic arginine sensor for mTORC1 subunit 1 N-terminal domain Domain
PF13840 ACT_7 71 139 ACT domain Domain
PF13840 ACT_7 258 322 ACT domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000303|PubMed:26972053}.
Sequence
MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFL
QVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT
DFILVREQDLSVVIHTLAQ
EFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP
QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV
MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST
FNFDHALVPEDGIGSVIEVLQR
RQEGLAS
Sequence length 329
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  mTOR signaling pathway   Amino acids regulate mTORC1
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 31305263
Neoplasms Associate 31305263