Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	65263
Gene name	Pyrroline-5-carboxylate reductase 3
Gene symbol	PYCR3
Synonyms (NCBI Gene)	PYCRL
Chromosome	8
Chromosome location	8q24.3
Summary	This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precurs

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT665130	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT665129	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT665128	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327
MIRT665127	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT665126	hsa-miR-924	HITS-CLIP	23824327
MIRT665125	hsa-miR-626	HITS-CLIP	23824327
MIRT665124	hsa-miR-6876-3p	HITS-CLIP	23824327
MIRT665123	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT665122	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327
MIRT621402	hsa-miR-6861-3p	HITS-CLIP	23824327
MIRT621401	hsa-miR-492	HITS-CLIP	23824327
MIRT621400	hsa-miR-659-5p	HITS-CLIP	23824327
MIRT621399	hsa-miR-4776-5p	HITS-CLIP	23824327
MIRT621398	hsa-miR-4535	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327
MIRT621402	hsa-miR-6861-3p	HITS-CLIP	23824327
MIRT621401	hsa-miR-492	HITS-CLIP	23824327
MIRT621400	hsa-miR-659-5p	HITS-CLIP	23824327
MIRT621399	hsa-miR-4776-5p	HITS-CLIP	23824327
MIRT621398	hsa-miR-4535	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327
MIRT616121	hsa-miR-1248	HITS-CLIP	23824327

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004735	Function	Pyrroline-5-carboxylate reductase activity	IBA
GO:0004735	Function	Pyrroline-5-carboxylate reductase activity	IDA	23024808, 36414121
GO:0004735	Function	Pyrroline-5-carboxylate reductase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	23024808
GO:0005829	Component	Cytosol	TAS
GO:0008652	Process	Amino acid biosynthetic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0055129	Process	L-proline biosynthetic process	IBA
GO:0055129	Process	L-proline biosynthetic process	IDA	23024808, 36414121
GO:0055129	Process	L-proline biosynthetic process	IEA
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
616408	25846	ENSG00000104524

Q53H96

Protein name

Pyrroline-5-carboxylate reductase 3 (P5C reductase 3) (P5CR 3) (EC 1.5.1.2) (Pyrroline-5-carboxylate reductase-like protein)

Protein function

Oxidoreductase that catalyzes the last step in proline biosynthesis, which corresponds to the reduction of pyrroline-5-carboxylate (P5C) to L-proline using NAD(P)H (PubMed:23024808, PubMed:36414121). Proline is synthesized from either glutamate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03807	F420_oxidored	10 → 104	NADP oxidoreductase coenzyme F420-dependent	Family
PF14748	P5CR_dimer	167 → 271	Pyrroline-5-carboxylate reductase dimerisation	Domain

Sequence

MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTH
SNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRV
LRVLPNLPCVVQEGAIVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSG
VAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGT
TIYGLHALEQGGLRAATMSAVEAATCRAKELSRK

Sequence length

274

Interactions

View interactions

	KEGG		Reactome
	Arginine and proline metabolism Metabolic pathways Biosynthesis of amino acids		Glutamate and glutamine metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEGMATOGENOUS RETINAL DETACHMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Neoplasms	Stimulate	36624948	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	40565055	★★★★★ ★☆☆☆☆ Found in Text Mining only

PYCR3 (pyrroline-5-carboxylate reductase 3)