Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6524
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 5 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC5A2
Synonyms (NCBI Gene) Gene synonyms aliases	SGLT2
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Show/Hide all(10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918621	G>A	Pathogenic	Intron variant, coding sequence variant, stop gained
rs200228142	G>A	Pathogenic-likely-pathogenic	Intron variant
rs267607067	A>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs398122801	C>A,G,T	Pathogenic	Intron variant
rs398122802	C>A,G,T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant, missense variant
rs770214617	->TT	Likely-pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs773289713	G>A,T	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs886037850	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1378076282	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1555496083	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529892	hsa-miR-3155a	PAR-CLIP	22012620
MIRT529891	hsa-miR-3155b	PAR-CLIP	22012620
MIRT529890	hsa-miR-484	PAR-CLIP	22012620
MIRT529889	hsa-miR-4286	PAR-CLIP	22012620
MIRT529887	hsa-miR-6886-5p	PAR-CLIP	22012620
MIRT529888	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT529886	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT529884	hsa-miR-3663-3p	PAR-CLIP	22012620
MIRT529885	hsa-miR-4268	PAR-CLIP	22012620
MIRT529883	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT529892	hsa-miR-3155a	PAR-CLIP	22012620
MIRT529891	hsa-miR-3155b	PAR-CLIP	22012620
MIRT529890	hsa-miR-484	PAR-CLIP	22012620
MIRT529889	hsa-miR-4286	PAR-CLIP	22012620
MIRT529887	hsa-miR-6886-5p	PAR-CLIP	22012620
MIRT529888	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT529886	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT529884	hsa-miR-3663-3p	PAR-CLIP	22012620
MIRT529885	hsa-miR-4268	PAR-CLIP	22012620
MIRT529883	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459800	hsa-miR-3155	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2626699	hsa-miR-1913	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2626700	hsa-miR-324-3p	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2626699	hsa-miR-1913	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2626700	hsa-miR-324-3p	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000017	Process	Alpha-glucoside transport	IDA	20980548, 26376857
GO:0005362	Function	Low-affinity glucose:sodium symporter activity	TAS	8244402
GO:0005412	Function	Glucose:sodium symporter activity	EXP	11133510
GO:0005412	Function	Glucose:sodium symporter activity	IBA	21873635
GO:0005412	Function	Glucose:sodium symporter activity	IDA	20980548
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	26376857
GO:0005886	Component	Plasma membrane	TAS
GO:0005975	Process	Carbohydrate metabolic process	TAS	8244402
GO:0006814	Process	Sodium ion transport	IBA	21873635
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015151	Function	Alpha-glucoside transmembrane transporter activity	IDA	20980548, 26376857
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	20980548
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098708	Process	Glucose import across plasma membrane	IDA	20980548
GO:0098719	Process	Sodium ion import across plasma membrane	IDA	20980548

MIM	HGNC	e!Ensembl
182381	11037	ENSG00000140675

Protein

UniProt ID

P31639

Protein name

Sodium/glucose cotransporter 2 (Na(+)/glucose cotransporter 2) (Low affinity sodium-glucose cotransporter) (Solute carrier family 5 member 2)

Protein function

Electrogenic Na(+)-coupled sugar symporter that actively transports D-glucose at the plasma membrane, with a Na(+) to sugar coupling ratio of 1:1 (PubMed:20980548, PubMed:28592437, PubMed:34880493, PubMed:37217492, PubMed:38057552). Transporter

PDB

7VSI , 7YNJ , 7YNK , 8HB0 , 8HDH , 8HEZ , 8HG7 , 8HIN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00474	SSF	55 → 492	Sodium:solute symporter family	Family

Sequence

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA

Sequence length

672

Interactions

View interactions

	Reactome
			Cellular hexose transport Defective SLC5A2 causes renal glucosuria (GLYS1)

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Renal glucosuria	Familial renal glucosuria	rs121918621, rs398122801, rs387906682, rs398122802, rs886037850, rs1309307492, rs1555496083, rs773289713, rs987447860, rs200228142, rs770214617	14614622, 21165652, 24255686

Show/Hide Text Mining Associations (63)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	38232717
Adenocarcinoma of Lung	Associate	38232717
Aortic Valve Stenosis	Associate	38247224
Asthma	Inhibit	39318474
Autistic Disorder	Associate	31969655
Breast Neoplasms	Associate	31776304
Calcinosis Cutis	Associate	11509120
Candidiasis	Associate	26735923
Carcinogenesis	Associate	35977549
Carcinoma Renal Cell	Associate	30521176
Cerebral Hemorrhage	Associate	40404687
Cerebral Infarction	Associate	39542148
COVID 19	Associate	34477316
Dental Plaque	Stimulate	34500107
Diabetes Mellitus	Stimulate	30291295
Diabetes Mellitus	Associate	30476138, 34500107, 35129424, 35229480, 35498407, 36096423
Diabetes Mellitus Type 2	Associate	26735923, 27611858, 28472182, 29341404, 34325887, 35879337, 37543256
Diabetic Ketoacidosis	Associate	38277514
Diabetic Nephropathies	Inhibit	31545924
Diabetic Nephropathies	Associate	31862399, 34200774, 34285121, 35129424, 36314849, 36768138, 38069385
Dumping Syndrome	Associate	33588940
Embolic Stroke	Inhibit	39542148
Epilepsy	Associate	31969655
Fatty Liver	Associate	35842345
Fibrosis	Associate	31545924, 31862399, 34003249, 38247224
Glomerulonephritis	Associate	31545924
Glucose Intolerance	Associate	33588940
Glycosuria	Associate	32227112
Glycosuria Renal	Associate	15610225, 16518345, 26376857, 26735923, 27000029, 30476138, 30558067, 31584752, 32034166, 32111189, 35229480
Heart Diseases	Associate	38247224
Heart Failure	Associate	30291295, 34028657, 34540994, 39217550
Heart Failure Diastolic	Associate	36549862
Heart Failure Systolic	Associate	36303443
Hepatorenal form of glycogen storage disease	Associate	33588940
Hyperglycemia	Associate	33588940
Hypobetalipoproteinemias	Associate	35842345
Hypoglycemia	Associate	26735923, 31584752, 32034166
Inflammation	Associate	34200774, 34500107, 36732760, 40404687
Insulin Resistance	Associate	29476696, 32100949, 35498407
Ketosis	Associate	38277514
Kidney Diseases	Associate	31862399
Long Qt Syndrome 2	Associate	26376857
Lung Diseases Interstitial	Inhibit	39318474
Lung Neoplasms	Associate	11509120
Lysosomal acid lipase deficiency	Associate	35842345
Metabolic Diseases	Associate	36096423
Myocardial Infarction	Associate	30291295
Neoplasms	Associate	30521176, 35662245
Non alcoholic Fatty Liver Disease	Associate	35842345
Osteosarcoma	Stimulate	35662245
Plaque Atherosclerotic	Associate	34500107
Pneumoconiosis	Inhibit	39318474
Polycythemia	Associate	36966432
Proteinuria	Associate	30476138
Pulmonary Arterial Hypertension	Associate	38325821
Renal Aminoacidurias	Associate	15610225
Renal Insufficiency Chronic	Associate	31545924, 33139635, 34540994
Tuberculosis	Associate	39318474
Tuberculosis Pulmonary	Inhibit	39318474
Undifferentiated Connective Tissue Diseases	Associate	30558067
Vascular Diseases	Associate	29307883
Ventricular Remodeling	Associate	38247224
Weight Loss	Associate	35842345

SLC5A2 (solute carrier family 5 member 2)