Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6524
Gene name	Solute carrier family 5 member 2
Gene symbol	SLC5A2
Synonyms (NCBI Gene)	SGLT2
Chromosome	16
Chromosome location	16p11.2
Summary	This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918621	G>A	Pathogenic	Intron variant, coding sequence variant, stop gained
rs200228142	G>A	Pathogenic-likely-pathogenic	Intron variant
rs267607067	A>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs398122801	C>A,G,T	Pathogenic	Intron variant
rs398122802	C>A,G,T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant, missense variant
rs770214617	->TT	Likely-pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs773289713	G>A,T	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs886037850	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1378076282	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1555496083	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529892	hsa-miR-3155a	PAR-CLIP	22012620
MIRT529891	hsa-miR-3155b	PAR-CLIP	22012620
MIRT529890	hsa-miR-484	PAR-CLIP	22012620
MIRT529889	hsa-miR-4286	PAR-CLIP	22012620
MIRT529887	hsa-miR-6886-5p	PAR-CLIP	22012620
MIRT529888	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT529886	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT529884	hsa-miR-3663-3p	PAR-CLIP	22012620
MIRT529885	hsa-miR-4268	PAR-CLIP	22012620
MIRT529883	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT529892	hsa-miR-3155a	PAR-CLIP	22012620
MIRT529891	hsa-miR-3155b	PAR-CLIP	22012620
MIRT529890	hsa-miR-484	PAR-CLIP	22012620
MIRT529889	hsa-miR-4286	PAR-CLIP	22012620
MIRT529887	hsa-miR-6886-5p	PAR-CLIP	22012620
MIRT529888	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT529886	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT529884	hsa-miR-3663-3p	PAR-CLIP	22012620
MIRT529885	hsa-miR-4268	PAR-CLIP	22012620
MIRT529883	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459800	hsa-miR-3155	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2626699	hsa-miR-1913	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2626700	hsa-miR-324-3p	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2626699	hsa-miR-1913	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2626700	hsa-miR-324-3p	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000017	Process	Alpha-glucoside transport	IDA	20980548, 26376857
GO:0005362	Function	Low-affinity D-glucose:sodium symporter activity	TAS	8244402
GO:0005412	Function	D-glucose:sodium symporter activity	EXP	11133510
GO:0005412	Function	D-glucose:sodium symporter activity	IBA
GO:0005412	Function	D-glucose:sodium symporter activity	IDA	20980548, 28592437
GO:0005412	Function	D-glucose:sodium symporter activity	TAS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781, 34880493, 38057552
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26376857
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005975	Process	Carbohydrate metabolic process	TAS	8244402
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IBA
GO:0006814	Process	Sodium ion transport	IEA
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015151	Function	Alpha-glucoside transmembrane transporter activity	IDA	20980548, 26376857
GO:0015293	Function	Symporter activity	IEA
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8244402
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035623	Process	Renal D-glucose absorption	IEA
GO:0035623	Process	Renal D-glucose absorption	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	20980548
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098708	Process	D-glucose import across plasma membrane	IDA	20980548
GO:0098719	Process	Sodium ion import across plasma membrane	IDA	20980548
GO:1904659	Process	D-glucose transmembrane transport	IEA

MIM	HGNC	e!Ensembl
182381	11037	ENSG00000140675

P31639

Protein name

Sodium/glucose cotransporter 2 (Na(+)/glucose cotransporter 2) (Low affinity sodium-glucose cotransporter) (Solute carrier family 5 member 2)

Protein function

Electrogenic Na(+)-coupled sugar symporter that actively transports D-glucose at the plasma membrane, with a Na(+) to sugar coupling ratio of 1:1 (PubMed:20980548, PubMed:28592437, PubMed:34880493, PubMed:37217492, PubMed:38057552). Transporter

PDB

7VSI , 7YNJ , 7YNK , 8HB0 , 8HDH , 8HEZ , 8HG7 , 8HIN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00474	SSF	55 → 492	Sodium:solute symporter family	Family

Sequence

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA

Sequence length

672

Interactions

View interactions

	Reactome
			Cellular hexose transport Defective SLC5A2 causes renal glucosuria (GLYS1)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Familial renal glucosuria	Likely pathogenic; Pathogenic	rs148410166, rs554372141, rs2082523114, rs886037850, rs749065127, rs764084563, rs121918621, rs768095044, rs2544889035, rs398122801, rs387906682, rs398122802, rs1309307492, rs1555496083, rs773289713, rs987447860, rs770214617 View all (2 more)	RCV002503164 RCV002506745 RCV003131528 RCV000239563 RCV003324614 RCV003324620 RCV000013767 RCV005021953 RCV003991390 RCV000022761 RCV000408654 RCV000022763 RCV000505656 RCV000625681 RCV000625556 RCV005021123 RCV000991458	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Gastric cancer	Likely pathogenic; Pathogenic	rs768095044	RCV005871154	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SLC5A2-related disorder	Likely pathogenic; Pathogenic	rs764084563, rs768095044, rs757061289, rs753455828, rs767121482	RCV003901011 RCV003419243 RCV003414575 RCV003391670 RCV003393251	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOSURIA, RENAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (63)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	38232717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	38232717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Associate	38247224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Inhibit	39318474	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Associate	31969655	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	31776304	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	11509120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Candidiasis	Associate	26735923	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	35977549	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	30521176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Associate	40404687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	39542148	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	34477316	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Plaque	Stimulate	34500107	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	30291295	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	30476138, 34500107, 35129424, 35229480, 35498407, 36096423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	26735923, 27611858, 28472182, 29341404, 34325887, 35879337, 37543256	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Associate	38277514	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Inhibit	31545924	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	31862399, 34200774, 34285121, 35129424, 36314849, 36768138, 38069385	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dumping Syndrome	Associate	33588940	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolic Stroke	Inhibit	39542148	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	31969655	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	35842345	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	31545924, 31862399, 34003249, 38247224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Associate	31545924	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Intolerance	Associate	33588940	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria	Associate	32227112	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Associate	15610225, 16518345, 26376857, 26735923, 27000029, 30476138, 30558067, 31584752, 32034166, 32111189, 35229480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	38247224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	30291295, 34028657, 34540994, 39217550	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Associate	36549862	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Associate	36303443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal form of glycogen storage disease	Associate	33588940	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Associate	33588940	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypobetalipoproteinemias	Associate	35842345	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Associate	26735923, 31584752, 32034166	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	34200774, 34500107, 36732760, 40404687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	29476696, 32100949, 35498407	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Associate	38277514	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	31862399	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Associate	26376857	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Inhibit	39318474	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	11509120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lysosomal acid lipase deficiency	Associate	35842345	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	36096423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	30291295	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30521176, 35662245	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	35842345	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Stimulate	35662245	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plaque Atherosclerotic	Associate	34500107	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumoconiosis	Inhibit	39318474	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Associate	36966432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Associate	30476138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	38325821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Aminoacidurias	Associate	15610225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Associate	31545924, 33139635, 34540994	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis	Associate	39318474	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis Pulmonary	Inhibit	39318474	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated Connective Tissue Diseases	Associate	30558067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	29307883	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Associate	38247224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Weight Loss	Associate	35842345	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC5A2 (solute carrier family 5 member 2)