Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6519
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 3 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC3A1
Synonyms (NCBI Gene) Gene synonyms aliases
ATR1, CSNU1, D2H, NBAT, RBAT
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associat
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs114640930 C>G,T Conflicting-interpretations-of-pathogenicity, benign Intron variant
rs121912691 T>A,C Conflicting-interpretations-of-pathogenicity, pathogenic Coding sequence variant, missense variant
rs121912694 G>A,T Pathogenic Coding sequence variant, missense variant
rs121912697 G>A Pathogenic Coding sequence variant, missense variant
rs184648701 T>C,G Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT443002 hsa-miR-548e-5p PAR-CLIP 22100165
MIRT443001 hsa-miR-382-5p PAR-CLIP 22100165
MIRT443002 hsa-miR-548e-5p PAR-CLIP 22100165
MIRT443001 hsa-miR-382-5p PAR-CLIP 22100165
MIRT2108036 hsa-miR-199a-5p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
PAX8 Activation 15673291
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12167606, 32494597
GO:0005774 Component Vacuolar membrane IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 8054986
GO:0005975 Process Carbohydrate metabolic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
104614 11025 ENSG00000138079
Protein
UniProt ID Q07837
Protein name Amino acid transporter heavy chain SLC3A1 (D2h) (Neutral and basic amino acid transport protein) (NBAT) (Solute carrier family 3 member 1) (b(0,+)-type amino acid transporter-related heavy chain) (rBAT)
Protein function Acts as a chaperone that facilitates biogenesis and trafficking of functional transporter heteromers to the plasma membrane (By similarity) (PubMed:10588648, PubMed:11318953, PubMed:16609684, PubMed:16825196, PubMed:32494597, PubMed:32817565, Pu
PDB 6LI9 , 6LID , 6YUP , 6YUZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00128 Alpha-amylase 140 492 Alpha amylase, catalytic domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brush border membrane in the kidney (at protein level). Predominantly expressed in the kidney, small intestine and pancreas. Weakly expressed in liver. {ECO:0000269|PubMed:12167606, ECO:0000269|PubMed:7686906, ECO:0000
Sequence
MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRGILGSQEPDFK
GVQPYAGMPKEVLFQFSGQARYRIPREILFWLTVASVLVLIAATIAIIALSPKCLDWWQE
GPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDF
REVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRTRTGKYTDYYIWH
DCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEIL
RFWLTKGVDGFSLDAVKFLLEAKHLRDEIQVNKTQIPDTVTQYSELYHDFTTTQVGMHDI
VRSFRQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFIQEADFPFNNYLSMLDTVS
GNSVYEVITSWMENMPEGKWPNWMIGGPDSSRLTSRLGNQYVNVMNMLLFTLPGTPITYY
GEEIGMGNIVAA
NLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDV
QKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFG
ESTLLNLHNMISGLPAKMRIRLSTNSADKGSKVDTSGIFLDKGEGLIFEHNTKNLLHRQT
AFRDRCFVSNRACYSSVLNILYTSC
Sequence length 685
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Protein digestion and absorption   Amino acid transport across the plasma membrane
Defective SLC3A1 causes cystinuria (CSNU)
Defective SLC7A9 causes cystinuria (CSNU)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cystinuria cystinuria rs201502095, rs1361526419, rs775827496, rs758627758, rs1553344107, rs767801148, rs121912691, rs779932118, rs121912693, rs778000327, rs121912694, rs567478582, rs387907276, rs1558450604, rs797044609
View all (6 more)
N/A
autism spectrum disorder Autism spectrum disorder rs200483989 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 31140607, 37304236
Cystinosis Associate 36421847
Cystinuria Associate 10620184, 10805464, 11524703, 12234283, 12841020, 16374432, 25964309, 28049243, 28166740, 33169184, 35577790, 36421847, 37525149, 38114997, 40428323
View all (4 more)
Cystinuria type 1 Associate 16385448
Cystinuria Type A Associate 10620184, 10805464, 11524703, 12234283, 16374432, 28166740, 35577790, 38114997
Distal myopathy Nonaka type Associate 38114997
Hypersensitivity Immediate Associate 35577790, 7568194
Hypotonia Cystinuria Syndrome Associate 24610330, 34612606
Mucolipidoses Associate 12841020
Myasthenic Syndromes Congenital Associate 24610330