Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6517
Gene name	Solute carrier family 2 member 4
Gene symbol	SLC2A4
Synonyms (NCBI Gene)	GLUT4
Chromosome	17
Chromosome location	17p13.1
Summary	This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is seque

337

Show/Hide all (337)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006559	hsa-miR-223-3p	FlowImmunoblotImmunofluorescenceImmunohistochemistryImmunoprecipitaionIn situ hybridizationLuciferase reporter assayNorthern blotqRT-PCR	20080987
MIRT019111	hsa-miR-335-5p	Microarray	18185580
MIRT038921	hsa-miR-92a-1-5p	CLASH	23622248
MIRT053085	hsa-miR-93-5p	Luciferase reporter assayqRT-PCRWestern blot	23493574
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT467784	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT467783	hsa-miR-1321	PAR-CLIP	23592263
MIRT467781	hsa-miR-4739	PAR-CLIP	23592263
MIRT467782	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT467780	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT467779	hsa-miR-4436a	PAR-CLIP	23592263
MIRT467778	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT467777	hsa-miR-4419a	PAR-CLIP	23592263
MIRT467776	hsa-miR-4510	PAR-CLIP	23592263
MIRT467775	hsa-miR-6127	PAR-CLIP	23592263
MIRT467774	hsa-miR-6129	PAR-CLIP	23592263
MIRT467773	hsa-miR-6130	PAR-CLIP	23592263
MIRT467772	hsa-miR-6133	PAR-CLIP	23592263
MIRT467771	hsa-miR-1286	PAR-CLIP	23592263
MIRT467770	hsa-miR-6077	PAR-CLIP	23592263
MIRT467769	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT467768	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT467766	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT467767	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	27418678
MIRT611339	hsa-miR-548ac	HITS-CLIP	27418678
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	27418678
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	27418678
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	27418678
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	27418678
MIRT611335	hsa-miR-548z	HITS-CLIP	27418678
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	27418678
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT467784	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT467783	hsa-miR-1321	PAR-CLIP	23592263
MIRT467781	hsa-miR-4739	PAR-CLIP	23592263
MIRT467782	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT467780	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT467779	hsa-miR-4436a	PAR-CLIP	23592263
MIRT467778	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT467777	hsa-miR-4419a	PAR-CLIP	23592263
MIRT467776	hsa-miR-4510	PAR-CLIP	23592263
MIRT467775	hsa-miR-6127	PAR-CLIP	23592263
MIRT467774	hsa-miR-6129	PAR-CLIP	23592263
MIRT467773	hsa-miR-6130	PAR-CLIP	23592263
MIRT467772	hsa-miR-6133	PAR-CLIP	23592263
MIRT467771	hsa-miR-1286	PAR-CLIP	23592263
MIRT467770	hsa-miR-6077	PAR-CLIP	23592263
MIRT467769	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT467768	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT467766	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT467767	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT1358879	hsa-miR-1203	CLIP-seq
MIRT1358880	hsa-miR-149	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358882	hsa-miR-2114	CLIP-seq
MIRT1358883	hsa-miR-24	CLIP-seq
MIRT1358884	hsa-miR-3064-5p	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT1358886	hsa-miR-3163	CLIP-seq
MIRT1358887	hsa-miR-3622b-5p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358892	hsa-miR-410	CLIP-seq
MIRT1358893	hsa-miR-4268	CLIP-seq
MIRT1358894	hsa-miR-4284	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358903	hsa-miR-4722-5p	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358905	hsa-miR-4755-3p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT1358908	hsa-miR-4787-3p	CLIP-seq
MIRT1358909	hsa-miR-4794	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358911	hsa-miR-548c-3p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT2106259	hsa-miR-1273	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2106260	hsa-miR-3156-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT2106261	hsa-miR-4251	CLIP-seq
MIRT2106262	hsa-miR-4252	CLIP-seq
MIRT2106263	hsa-miR-4301	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT2106264	hsa-miR-4486	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT2106265	hsa-miR-4649-5p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT2106266	hsa-miR-4793-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT2106267	hsa-miR-539	CLIP-seq
MIRT2106268	hsa-miR-661	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358879	hsa-miR-1203	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358882	hsa-miR-2114	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2330576	hsa-miR-3192	CLIP-seq
MIRT2330577	hsa-miR-361-3p	CLIP-seq
MIRT1358887	hsa-miR-3622b-5p	CLIP-seq
MIRT2330578	hsa-miR-3679-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT2330579	hsa-miR-3934	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT2330580	hsa-miR-4662a-5p	CLIP-seq
MIRT2330581	hsa-miR-4676-5p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358903	hsa-miR-4722-5p	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358908	hsa-miR-4787-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT2330582	hsa-miR-490-3p	CLIP-seq
MIRT2330583	hsa-miR-575	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358879	hsa-miR-1203	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358882	hsa-miR-2114	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2624679	hsa-miR-3613-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT2624680	hsa-miR-371-5p	CLIP-seq
MIRT2624681	hsa-miR-371b-5p	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT1358908	hsa-miR-4787-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358911	hsa-miR-548c-3p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2624679	hsa-miR-3613-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT2624680	hsa-miR-371-5p	CLIP-seq
MIRT2624681	hsa-miR-371b-5p	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358911	hsa-miR-548c-3p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
HDAC4	Unknown	23899560
HDAC5	Repression	22991226
HDAC5	Unknown	23899560
MEF2A	Activation	14630949;18198354
MEF2A	Unknown	15294043
PPARG	Repression	16670091
SLC2A4RG	Activation	14630949

Show/Hide all (83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19478182, 25910212, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005802	Component	Trans-Golgi network	IDA	12467732
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	31112275
GO:0005886	Component	Plasma membrane	IDA	12556481, 19590752
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	2649253
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	2649253
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0007614	Process	Short-term memory	IEA
GO:0007614	Process	Short-term memory	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0007616	Process	Long-term memory	ISS
GO:0009897	Component	External side of plasma membrane	IDA	14562105
GO:0009986	Component	Cell surface	IEA
GO:0010021	Process	Amylopectin biosynthetic process	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0012505	Component	Endomembrane system	ISS
GO:0012506	Component	Vesicle membrane	IDA	14562105
GO:0015304	Function	D-glucose uniporter activity	IEA
GO:0015304	Function	D-glucose uniporter activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2649253
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030136	Component	Clathrin-coated vesicle	IDA	19478182
GO:0030140	Component	Trans-Golgi network transport vesicle	IEA
GO:0030315	Component	T-tubule	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	IEA
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	ISS
GO:0031982	Component	Vesicle	IEA
GO:0032593	Component	Insulin-responsive compartment	IDA	19590752
GO:0032593	Component	Insulin-responsive compartment	IEA
GO:0032593	Component	Insulin-responsive compartment	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IBA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	12556481
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042383	Component	Sarcolemma	ISS
GO:0042593	Process	Glucose homeostasis	IDA	14562105
GO:0042593	Process	Glucose homeostasis	IDA	17003346
GO:0044381	Process	Glucose import in response to insulin stimulus	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046323	Process	D-glucose import	IBA
GO:0046323	Process	D-glucose import	IEA
GO:0046323	Process	D-glucose import	NAS	11742412
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12556481, 14562105, 19590752
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	25004245
GO:0055056	Function	D-glucose transmembrane transporter activity	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	ISS
GO:0055056	Function	D-glucose transmembrane transporter activity	TAS	2649253
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	IEA
GO:0070343	Process	White fat cell proliferation	ISS	36228616
GO:0070837	Process	Dehydroascorbic acid transport	IBA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071470	Process	Cellular response to osmotic stress	IEA
GO:0098694	Process	Regulation of synaptic vesicle budding from presynaptic endocytic zone membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1904659	Process	D-glucose transmembrane transport	IEA
GO:1904659	Process	D-glucose transmembrane transport	IEA
GO:1904659	Process	D-glucose transmembrane transport	ISS
GO:1904659	Process	D-glucose transmembrane transport	TAS	2649253, 12556481

MIM	HGNC	e!Ensembl
138190	11009	ENSG00000181856

P14672

Protein name

Solute carrier family 2, facilitated glucose transporter member 4 (Glucose transporter type 4, insulin-responsive) (GLUT-4)

Protein function

Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracel

PDB

7WSM , 7WSN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	27 → 483	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Skeletal and cardiac muscles; brown and white fat.

Sequence

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND

Sequence length

509

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway AMPK signaling pathway Insulin signaling pathway Adipocytokine signaling pathway Type II diabetes mellitus Insulin resistance Diabetic cardiomyopathy		Cellular hexose transport Transcriptional regulation of white adipocyte differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 2 diabetes mellitus	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	10950817, 34488531, 34525987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	33570246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31180527, 37549925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Stimulate	22028857	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Hypertrophic	Associate	32455814	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	29504525	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	35468725	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Associate	31261961	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Stimulate	27981520	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	30805369, 35532201, 35712865	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	16538490, 17107852, 28973736, 34360895, 37158952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	20602301, 27981520	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Inhibit	37174649	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	28973736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	1918382, 20625434, 21796809, 22673408, 29382080, 30805369, 32851733, 33989714, 37520260	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	19816414, 1999488, 22114711, 28944847, 32455814, 35363363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Stimulate	20602301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	36792603	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	30049187	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disease Progression	Associate	22381410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Inhibit	26640142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Associate	22381410, 34218261	★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin type ichthyosis	Inhibit	20011249	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Associate	19118529	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Inhibit	22937169	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Inhibit	35363363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	24410986	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Inhibit	26622051	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	35711425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Inhibit	37759548	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	23640464	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	19556978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	26718495, 35485360	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	16775236, 17227768, 21757715, 23805253, 26355033, 28944847, 29097553, 29333450, 30623452, 31389668, 32382742, 32662257, 32851733, 33509040, 35406631, 37453421 View all (1 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Stimulate	17986714	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Inhibit	22114711, 22403297, 23493574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Lymphocytic Chronic B Cell	Associate	24828872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	27786596	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	22381410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Stimulate	23669880	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	29504525, 37033267	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	22452979, 26640142, 35082341	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Inhibit	29504525	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscle Neoplasms	Associate	29687616	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Diseases	Associate	40141055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathies Structural Congenital	Associate	36142275	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27786596, 28061796, 29504525	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	29382080, 29504525, 30419905, 36012230, 37549925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	34488531	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	22309242	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	19118529	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Inhibit	1999488, 22457223, 37174649	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	27467133, 30813326, 32455814	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Inhibit	35363363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	36012230	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	9293784	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Associate	9293784	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Inhibit	20011249, 23493574, 25064406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	30623452, 31874063, 32382742, 33228780, 35485360, 37047828	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	27121963, 31422041, 33619826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Inhibit	18635880	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Associate	24410986	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	28061796, 30049187, 35920070, 37542344	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	25925563, 31124603, 33570246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Inhibit	29978611	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	32425887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Stimulate	31074654	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC2A4 (solute carrier family 2 member 4)