Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6512
Gene name	Solute carrier family 1 member 7
Gene symbol	SLC1A7
Synonyms (NCBI Gene)	AAATEAAT5
Chromosome	1
Chromosome location	1p32.3

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT528527	hsa-miR-6501-3p	PAR-CLIP	22012620
MIRT528526	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT528525	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528524	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT528523	hsa-miR-8073	PAR-CLIP	22012620
MIRT528522	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT528521	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT528520	hsa-miR-4660	PAR-CLIP	22012620
MIRT528519	hsa-miR-604	PAR-CLIP	22012620
MIRT528518	hsa-miR-6762-3p	PAR-CLIP	22012620
MIRT528517	hsa-miR-647	PAR-CLIP	22012620
MIRT528527	hsa-miR-6501-3p	PAR-CLIP	22012620
MIRT528526	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT528525	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528524	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT528523	hsa-miR-8073	PAR-CLIP	22012620
MIRT528522	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT528521	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT528520	hsa-miR-4660	PAR-CLIP	22012620
MIRT528519	hsa-miR-604	PAR-CLIP	22012620
MIRT528518	hsa-miR-6762-3p	PAR-CLIP	22012620
MIRT528517	hsa-miR-647	PAR-CLIP	22012620
MIRT1354184	hsa-miR-1245b-5p	CLIP-seq
MIRT1354185	hsa-miR-1253	CLIP-seq
MIRT1354186	hsa-miR-1254	CLIP-seq
MIRT1354187	hsa-miR-2110	CLIP-seq
MIRT1354188	hsa-miR-3116	CLIP-seq
MIRT1354189	hsa-miR-3142	CLIP-seq
MIRT1354190	hsa-miR-3150a-3p	CLIP-seq
MIRT1354191	hsa-miR-3175	CLIP-seq
MIRT1354192	hsa-miR-3689a-3p	CLIP-seq
MIRT1354193	hsa-miR-3689c	CLIP-seq
MIRT1354194	hsa-miR-4260	CLIP-seq
MIRT1354195	hsa-miR-4650-5p	CLIP-seq
MIRT1354196	hsa-miR-4728-5p	CLIP-seq
MIRT1354197	hsa-miR-4804-5p	CLIP-seq
MIRT1354198	hsa-miR-513c	CLIP-seq
MIRT1354199	hsa-miR-514b-5p	CLIP-seq
MIRT1354200	hsa-miR-518a-5p	CLIP-seq
MIRT1354201	hsa-miR-527	CLIP-seq
MIRT1354202	hsa-miR-890	CLIP-seq
MIRT1354203	hsa-miR-939	CLIP-seq
MIRT2104758	hsa-miR-1205	CLIP-seq
MIRT1354186	hsa-miR-1254	CLIP-seq
MIRT2104759	hsa-miR-2861	CLIP-seq
MIRT1354188	hsa-miR-3116	CLIP-seq
MIRT2104760	hsa-miR-3690	CLIP-seq
MIRT2104761	hsa-miR-4638-3p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001504	Process	Neurotransmitter uptake	IDA	9108121
GO:0001504	Process	Neurotransmitter uptake	IMP	9108121
GO:0001504	Process	Neurotransmitter uptake	NAS	9108121
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IEA
GO:0005313	Function	L-glutamate transmembrane transporter activity	TAS	9108121
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006835	Process	Dicarboxylic acid transport	TAS	9108121
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0008068	Function	Extracellularly glutamate-gated chloride channel activity	ISS
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015293	Function	Symporter activity	IEA
GO:0015501	Function	Glutamate:sodium symporter activity	IBA
GO:0015501	Function	Glutamate:sodium symporter activity	IDA	9108121
GO:0015501	Function	Glutamate:sodium symporter activity	IEA
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	IBA
GO:0015813	Process	L-glutamate transmembrane transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098657	Process	Import into cell	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1902476	Process	Chloride transmembrane transport	ISS

MIM	HGNC	e!Ensembl
604471	10945	ENSG00000162383

O00341

Protein name

Excitatory amino acid transporter 5 (Retinal glutamate transporter) (Solute carrier family 1 member 7)

Protein function

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one p

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00375	SDF	19 → 476	Sodium:dicarboxylate symporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in retina. Detectable in liver, heart, muscle and brain. {ECO:0000269|PubMed:9108121}.

Sequence

MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRM
LKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAA
QKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPR
RILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMG
DSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTV
VCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNH
IDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKD
FARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEE
LPAASLNHCTIQISELETNV

Sequence length

560

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Glutamatergic synapse		Glutamate Neurotransmitter Release Cycle Transport of inorganic cations/anions and amino acids/oligopeptides

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Depressive Disorder Major	Associate	31123248	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Associate	33568133	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Associate	36397361	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC1A7 (solute carrier family 1 member 7)