Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6512
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 1 member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC1A7
Synonyms (NCBI Gene) Gene synonyms aliases	AAAT, EAAT5
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p32.3

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT528527	hsa-miR-6501-3p	PAR-CLIP	22012620
MIRT528526	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT528525	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528524	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT528523	hsa-miR-8073	PAR-CLIP	22012620
MIRT528522	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT528521	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT528520	hsa-miR-4660	PAR-CLIP	22012620
MIRT528519	hsa-miR-604	PAR-CLIP	22012620
MIRT528518	hsa-miR-6762-3p	PAR-CLIP	22012620
MIRT528517	hsa-miR-647	PAR-CLIP	22012620
MIRT528527	hsa-miR-6501-3p	PAR-CLIP	22012620
MIRT528526	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT528525	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528524	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT528523	hsa-miR-8073	PAR-CLIP	22012620
MIRT528522	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT528521	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT528520	hsa-miR-4660	PAR-CLIP	22012620
MIRT528519	hsa-miR-604	PAR-CLIP	22012620
MIRT528518	hsa-miR-6762-3p	PAR-CLIP	22012620
MIRT528517	hsa-miR-647	PAR-CLIP	22012620
MIRT1354184	hsa-miR-1245b-5p	CLIP-seq
MIRT1354185	hsa-miR-1253	CLIP-seq
MIRT1354186	hsa-miR-1254	CLIP-seq
MIRT1354187	hsa-miR-2110	CLIP-seq
MIRT1354188	hsa-miR-3116	CLIP-seq
MIRT1354189	hsa-miR-3142	CLIP-seq
MIRT1354190	hsa-miR-3150a-3p	CLIP-seq
MIRT1354191	hsa-miR-3175	CLIP-seq
MIRT1354192	hsa-miR-3689a-3p	CLIP-seq
MIRT1354193	hsa-miR-3689c	CLIP-seq
MIRT1354194	hsa-miR-4260	CLIP-seq
MIRT1354195	hsa-miR-4650-5p	CLIP-seq
MIRT1354196	hsa-miR-4728-5p	CLIP-seq
MIRT1354197	hsa-miR-4804-5p	CLIP-seq
MIRT1354198	hsa-miR-513c	CLIP-seq
MIRT1354199	hsa-miR-514b-5p	CLIP-seq
MIRT1354200	hsa-miR-518a-5p	CLIP-seq
MIRT1354201	hsa-miR-527	CLIP-seq
MIRT1354202	hsa-miR-890	CLIP-seq
MIRT1354203	hsa-miR-939	CLIP-seq
MIRT2104758	hsa-miR-1205	CLIP-seq
MIRT1354186	hsa-miR-1254	CLIP-seq
MIRT2104759	hsa-miR-2861	CLIP-seq
MIRT1354188	hsa-miR-3116	CLIP-seq
MIRT2104760	hsa-miR-3690	CLIP-seq
MIRT2104761	hsa-miR-4638-3p	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001504	Process	Neurotransmitter uptake	IDA	9108121
GO:0001504	Process	Neurotransmitter uptake	IMP	9108121
GO:0001504	Process	Neurotransmitter uptake	NAS	9108121
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IEA
GO:0005313	Function	L-glutamate transmembrane transporter activity	TAS	9108121
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006835	Process	Dicarboxylic acid transport	TAS	9108121
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0008068	Function	Extracellularly glutamate-gated chloride channel activity	ISS
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015293	Function	Symporter activity	IEA
GO:0015501	Function	Glutamate:sodium symporter activity	IBA
GO:0015501	Function	Glutamate:sodium symporter activity	IDA	9108121
GO:0015501	Function	Glutamate:sodium symporter activity	IEA
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	IBA
GO:0015813	Process	L-glutamate transmembrane transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098657	Process	Import into cell	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1902476	Process	Chloride transmembrane transport	ISS

MIM	HGNC	e!Ensembl
604471	10945	ENSG00000162383

Protein

UniProt ID

O00341

Protein name

Excitatory amino acid transporter 5 (Retinal glutamate transporter) (Solute carrier family 1 member 7)

Protein function

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one p

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00375	SDF	19 → 476	Sodium:dicarboxylate symporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in retina. Detectable in liver, heart, muscle and brain. {ECO:0000269|PubMed:9108121}.

Sequence

MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRM
LKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAA
QKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPR
RILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMG
DSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTV
VCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNH
IDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKD
FARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEE
LPAASLNHCTIQISELETNV

Sequence length

560

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Glutamatergic synapse		Glutamate Neurotransmitter Release Cycle Transport of inorganic cations/anions and amino acids/oligopeptides

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dementia	Dementia	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Depressive Disorder Major	Associate	31123248
Gaucher Disease	Associate	33568133
Graves Disease	Associate	36397361

SLC1A7 (solute carrier family 1 member 7)