SLC1A6 (solute carrier family 1 member 6)

Gene

• Entrez ID: 6511
• Gene name: Solute carrier family 1 member 6
• Gene symbol: SLC1A6
• Synonyms (NCBI Gene): EAAT4
• Chromosome: 19
• Chromosome location: 19p13.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028877	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001504	Process	Neurotransmitter uptake	IDA	7791878
GO:0001504	Process	Neurotransmitter uptake	IMP	7791878
GO:0001504	Process	Neurotransmitter uptake	NAS	7791878
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IDA	7791878
GO:0005313	Function	L-glutamate transmembrane transporter activity	IEA
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	ISS
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	7791878
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0006865	Process	Amino acid transport	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	7791878
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015183	Function	L-aspartate transmembrane transporter activity	IDA	7791878
GO:0015183	Function	L-aspartate transmembrane transporter activity	TAS	7791878
GO:0015293	Function	Symporter activity	IEA
GO:0015501	Function	Glutamate:sodium symporter activity	IBA
GO:0015501	Function	Glutamate:sodium symporter activity	IDA	7791878
GO:0015501	Function	Glutamate:sodium symporter activity	IEA
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015810	Process	Aspartate transmembrane transport	TAS	7791878
GO:0015813	Process	L-glutamate transmembrane transport	IBA
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	TAS	7791878
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7791878
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0046872	Function	Metal ion binding	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0098657	Process	Import into cell	IEA
GO:0098712	Process	L-glutamate import across plasma membrane	IDA	7791878
GO:0098712	Process	L-glutamate import across plasma membrane	ISS
GO:0098796	Component	Membrane protein complex	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140009	Process	L-aspartate import across plasma membrane	IDA	7791878

Other IDs

• MIM: 600637
• HGNC: 10944
• e!Ensembl: ENSG00000105143

Protein

• UniProt ID: P48664
• Protein name: Excitatory amino acid transporter 4 (Sodium-dependent glutamate/aspartate transporter) (Solute carrier family 1 member 6)
• Protein function: Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:26690923, PubMed:7791878). Functions as a symporter that transports one amino acid molecule together with
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00375	SDF	58 → 522	Sodium:dicarboxylate symporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Brain, mainly in the cerebellum (PubMed:7791878). Expressed densely and selectively in cell bodies of Purkinje cells. {ECO:0000269|PubMed:7791878}.
• Sequence:

  MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFIL
  LTVSAVVIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLD
  NKATGRMGMRAAVYYMVTTIIAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMD
  LIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENV
  TRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLN
  EAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGIVLPL
  IYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA
  TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVL
  TSVGLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLG
  KPYKSLMAQEKGASRGRGGNESAM

• Sequence length: 564

Pathways

KEGG:

Synaptic vesicle cycle
Glutamatergic synapse
Spinocerebellar ataxia

Reactome:

Glutamate Neurotransmitter Release Cycle
Transport of inorganic cations/anions and amino acids/oligopeptides

<