Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65080
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial ribosomal protein L44
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRPL44
Synonyms (NCBI Gene) Gene synonyms aliases
COXPD16, L44MT, MRP-L44, mL44
Disease Acronyms (UniProt) Disease acronyms from UniProt database
COXPD16
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q36.1
Summary Summary of gene provided in NCBI Entrez Gene.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143697995 T>C,G Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs144037629 C>T Likely-pathogenic Coding sequence variant, missense variant
rs1574796091 T>A Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022007 hsa-miR-128-3p Sequencing 20371350
MIRT027245 hsa-miR-101-3p Sequencing 20371350
MIRT656177 hsa-miR-3973 HITS-CLIP 23824327
MIRT656176 hsa-miR-520g-3p HITS-CLIP 23824327
MIRT656175 hsa-miR-520h HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0003725 Function Double-stranded RNA binding IBA 21873635
GO:0004525 Function Ribonuclease III activity IBA 21873635
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611849 16650 ENSG00000135900
Protein
UniProt ID Q9H9J2
Protein name Large ribosomal subunit protein mL44 (EC 3.1.26.-) (39S ribosomal protein L44, mitochondrial) (L44mt) (MRP-L44)
Protein function Component of the 39S subunit of mitochondrial ribosome. May have a function in the assembly/stability of nascent mitochondrial polypeptides exiting the ribosome.
PDB 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6
Family and domains
Sequence
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRR
SEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLK
SNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTL
SEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGL
LVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA
LRKLYGFTENRRPWNYSKPKETLRAEKSITAS
Sequence length 332
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Combined oxidative phosphorylation deficiency COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 16 rs587776508, rs576462794, rs118203917, rs387906327, rs139430866, rs387906962, rs138119149, rs387907061, rs1562800908, rs397515421, rs397514598, rs397514610, rs397514611, rs397514612, rs201431517
View all (155 more)
23315540
Hypertrophic cardiomyopathy Hypertrophic Cardiomyopathy, Infantile hypertrophic cardiomyopathy due to MRPL44 deficiency rs63750743, rs104894655, rs121908987, rs587776643, rs28938173, rs121908989, rs121908991, rs267606977, rs267606978, rs193922384, rs121909374, rs886041030, rs886041031, rs121909375, rs121909377
View all (752 more)
Unknown
Disease term Disease name Evidence References Source
Mitochondrial Diseases mitochondrial disease GenCC
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Lactic Associate 34140213
Asthma Associate 30206357
Cardiomyopathies Associate 34140213
Cardiomyopathy Hypertrophic Associate 34140213
Colorectal Neoplasms Associate 36299603
Drug Hypersensitivity Associate 30206357
Fatigue Associate 34140213
Lymphatic Metastasis Associate 25590838
Mitochondrial Diseases Associate 34140213
Muscle Weakness Associate 34140213