Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65080
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial ribosomal protein L44
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRPL44
Synonyms (NCBI Gene) Gene synonyms aliases
COXPD16, L44MT, MRP-L44, mL44
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q36.1
Summary Summary of gene provided in NCBI Entrez Gene.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143697995 T>C,G Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs144037629 C>T Likely-pathogenic Coding sequence variant, missense variant
rs1574796091 T>A Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022007 hsa-miR-128-3p Sequencing 20371350
MIRT027245 hsa-miR-101-3p Sequencing 20371350
MIRT656177 hsa-miR-3973 HITS-CLIP 23824327
MIRT656176 hsa-miR-520g-3p HITS-CLIP 23824327
MIRT656175 hsa-miR-520h HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IEA
GO:0003725 Function Double-stranded RNA binding IEA
GO:0004518 Function Nuclease activity IEA
GO:0004519 Function Endonuclease activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611849 16650 ENSG00000135900
Protein
UniProt ID Q9H9J2
Protein name Large ribosomal subunit protein mL44 (EC 3.1.26.-) (39S ribosomal protein L44, mitochondrial) (L44mt) (MRP-L44)
Protein function Component of the 39S subunit of mitochondrial ribosome. May have a function in the assembly/stability of nascent mitochondrial polypeptides exiting the ribosome.
PDB 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6
Family and domains
Sequence
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRR
SEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLK
SNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTL
SEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGL
LVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA
LRKLYGFTENRRPWNYSKPKETLRAEKSITAS
Sequence length 332
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Mitochondrial translation elongation
Mitochondrial translation termination
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hypertrophic Cardiomyopathy infantile hypertrophic cardiomyopathy due to mrpl44 deficiency rs143697995 N/A
Hepatoencephalopathy hepatoencephalopathy due to combined oxidative phosphorylation defect type 1 rs1574796091 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mitochondrial Diseases mitochondrial disease N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Lactic Associate 34140213
Asthma Associate 30206357
Cardiomyopathies Associate 34140213
Cardiomyopathy Hypertrophic Associate 34140213
Colorectal Neoplasms Associate 36299603
Drug Hypersensitivity Associate 30206357
Fatigue Associate 34140213
Lymphatic Metastasis Associate 25590838
Mitochondrial Diseases Associate 34140213
Muscle Weakness Associate 34140213