Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65062
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 237
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM237
Synonyms (NCBI Gene) Gene synonyms aliases
ALS2CR4, JBTS14
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a tetraspanin protein that is thought to be involved in WNT signaling. Defects in this gene are a cause of Joubert syndrome-14. Two transcript variants encoding different isoforms have been found for this gene. [provide
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs138509553 C>A,G,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs149240122 G>C Conflicting-interpretations-of-pathogenicity, benign, uncertain-significance Coding sequence variant, synonymous variant
rs199469707 G>A Pathogenic Coding sequence variant, stop gained
rs387907131 G>A Pathogenic Coding sequence variant, stop gained
rs730882231 C>T Likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045657 hsa-miR-149-5p CLASH 23622248
MIRT496667 hsa-miR-548aa PAR-CLIP 22291592
MIRT496666 hsa-miR-548ap-3p PAR-CLIP 22291592
MIRT496665 hsa-miR-548t-3p PAR-CLIP 22291592
MIRT496664 hsa-miR-1911-3p PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26595381, 32296183, 35156780, 36012204
GO:0005886 Component Plasma membrane IDA
GO:0005929 Component Cilium IDA
GO:0005929 Component Cilium IEA
GO:0015630 Component Microtubule cytoskeleton IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614423 14432 ENSG00000155755
Protein
UniProt ID Q96Q45
Protein name Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)
Protein function Component of the transition zone in primary cilia. Required for ciliogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15383 TMEM237 140 384 Transmembrane protein 237 Family
Sequence
MRTDSGARLEEGHLRPPRALPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRR
PSEGNEPSTKELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEPAE
EAVIQKPRRKTKKTQPAELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVF
VEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALTVHRAFRMIGLFSHGFLAGCA
VWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAI
RNFLALDPTALASFLYFTALILSLSQQMTSDRIHLYTPSSVNGSLWEAGIEEQILQPWIV
VNLVVALLVGLSWLFLSYRPGMDL
SEELMFSSEVEEYPDKEKEIKASS
Sequence length 408
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cerebellar vermis agenesis familial aplasia of the vermis rs199469707, rs1574587553 N/A
Joubert Syndrome joubert syndrome 14, Joubert syndrome and related disorders rs730882231, rs972221242, rs1445957469, rs775449384, rs793888505, rs199469707, rs1574587553, rs1574582671, rs387907131, rs80034299, rs748510210 N/A
Meckel-Gruber Syndrome meckel-gruber syndrome rs730882231 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Joubert Syndrome With Oculorenal Defect Joubert syndrome with oculorenal defect N/A N/A GenCC
Joubert Syndrome With Renal Defect Joubert syndrome with renal defect N/A N/A GenCC
Meckel Syndrome Meckel syndrome N/A N/A GenCC
retinal dystrophy Retinal dystrophy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Agenesis of Cerebellar Vermis Associate 26729329, 28596487
Ciliopathies Associate 28596487
Developmental Disabilities Associate 31238879
Meckel syndrome type 1 Associate 26729329
Neoplasms Associate 28236344
Squamous Cell Carcinoma of Head and Neck Associate 28236344