Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6503
Gene name	Src like adaptor
Gene symbol	SLA
Synonyms (NCBI Gene)	SLA1SLAP
Chromosome	8
Chromosome location	8q24.22

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments
MIRT1351345	hsa-miR-1193	CLIP-seq
MIRT1351346	hsa-miR-3064-3p	CLIP-seq
MIRT1351347	hsa-miR-3159	CLIP-seq
MIRT1351348	hsa-miR-325	CLIP-seq
MIRT1351349	hsa-miR-383	CLIP-seq
MIRT1351350	hsa-miR-4300	CLIP-seq
MIRT1351351	hsa-miR-4772-5p	CLIP-seq
MIRT1351352	hsa-miR-920	CLIP-seq
MIRT1351353	hsa-miR-1258	CLIP-seq
MIRT1351354	hsa-miR-1267	CLIP-seq
MIRT1351355	hsa-miR-1275	CLIP-seq
MIRT1351356	hsa-miR-188-5p	CLIP-seq
MIRT1351357	hsa-miR-1915	CLIP-seq
MIRT1351358	hsa-miR-204	CLIP-seq
MIRT1351359	hsa-miR-211	CLIP-seq
MIRT1351360	hsa-miR-2355-5p	CLIP-seq
MIRT1351361	hsa-miR-3117-3p	CLIP-seq
MIRT1351362	hsa-miR-3147	CLIP-seq
MIRT1351363	hsa-miR-3150a-5p	CLIP-seq
MIRT1351364	hsa-miR-3150b-5p	CLIP-seq
MIRT1351365	hsa-miR-3169	CLIP-seq
MIRT1351366	hsa-miR-3182	CLIP-seq
MIRT1351367	hsa-miR-3945	CLIP-seq
MIRT1351368	hsa-miR-4253	CLIP-seq
MIRT1351369	hsa-miR-4270	CLIP-seq
MIRT1351370	hsa-miR-4326	CLIP-seq
MIRT1351371	hsa-miR-4425	CLIP-seq
MIRT1351372	hsa-miR-4441	CLIP-seq
MIRT1351373	hsa-miR-4652-3p	CLIP-seq
MIRT1351374	hsa-miR-4661-3p	CLIP-seq
MIRT1351375	hsa-miR-4665-5p	CLIP-seq
MIRT1351376	hsa-miR-4726-3p	CLIP-seq
MIRT1351377	hsa-miR-4759	CLIP-seq
MIRT1351351	hsa-miR-4772-5p	CLIP-seq
MIRT1351378	hsa-miR-494	CLIP-seq
MIRT1351379	hsa-miR-548a-3p	CLIP-seq
MIRT1351380	hsa-miR-548e	CLIP-seq
MIRT1351381	hsa-miR-548f	CLIP-seq
MIRT1351382	hsa-miR-548g	CLIP-seq
MIRT1351383	hsa-miR-892a	CLIP-seq
MIRT2104120	hsa-miR-1237	CLIP-seq
MIRT2104121	hsa-miR-1248	CLIP-seq
MIRT2104122	hsa-miR-1270	CLIP-seq
MIRT2104123	hsa-miR-1284	CLIP-seq
MIRT2104124	hsa-miR-145	CLIP-seq
MIRT2104125	hsa-miR-149	CLIP-seq
MIRT2104126	hsa-miR-185	CLIP-seq
MIRT2104127	hsa-miR-1910	CLIP-seq
MIRT2104128	hsa-miR-2278	CLIP-seq
MIRT2104129	hsa-miR-3064-5p	CLIP-seq
MIRT2104130	hsa-miR-3189-3p	CLIP-seq
MIRT2104131	hsa-miR-326	CLIP-seq
MIRT2104132	hsa-miR-330-5p	CLIP-seq
MIRT2104133	hsa-miR-4274	CLIP-seq
MIRT2104134	hsa-miR-4279	CLIP-seq
MIRT2104135	hsa-miR-4306	CLIP-seq
MIRT2104136	hsa-miR-432	CLIP-seq
MIRT2104137	hsa-miR-4474-3p	CLIP-seq
MIRT2104138	hsa-miR-4531	CLIP-seq
MIRT2104139	hsa-miR-4644	CLIP-seq
MIRT2104140	hsa-miR-4753-3p	CLIP-seq
MIRT2104141	hsa-miR-4794	CLIP-seq
MIRT2104142	hsa-miR-4799-5p	CLIP-seq
MIRT2104143	hsa-miR-502-5p	CLIP-seq
MIRT2104144	hsa-miR-620	CLIP-seq
MIRT2104145	hsa-miR-942	CLIP-seq
MIRT2328239	hsa-miR-3713	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	9742401, 16273093, 24658140, 28514442, 31980649, 32296183, 33961781
GO:0005654	Component	Nucleoplasm	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0008180	Component	COP9 signalosome	IBA
GO:0043408	Process	Regulation of MAPK cascade	IBA

MIM	HGNC	e!Ensembl
601099	10902	ENSG00000155926

Q13239

Protein name

Src-like-adapter (Src-like-adapter protein 1) (SLAP-1) (hSLAP)

Protein function

Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-c

PDB

2CUD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	29 → 74	SH3 domain	Domain
PF00017	SH2	84 → 160	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9660183}.

Sequence

MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWK
AISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFY
SLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQST
AAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLT
SEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED

Sequence length

276

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE ACUTE RESPIRATORY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35325730, 38015097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	11870500, 15750208	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	24457997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	17002787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Associate	17006990, 36741403	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	35973983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	26869285	★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado Joseph Disease	Associate	25914309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11870500, 15750208, 26869285	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	24457997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	34091115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Associate	30485936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Associate	15750208	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLA (Src like adaptor)