Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6503
Gene name Gene Name - the full gene name approved by the HGNC.
Src like adaptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLA
Synonyms (NCBI Gene) Gene synonyms aliases
SLA1, SLAP
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.22
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1351345 hsa-miR-1193 CLIP-seq
MIRT1351346 hsa-miR-3064-3p CLIP-seq
MIRT1351347 hsa-miR-3159 CLIP-seq
MIRT1351348 hsa-miR-325 CLIP-seq
MIRT1351349 hsa-miR-383 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IBA
GO:0005154 Function Epidermal growth factor receptor binding IBA
GO:0005515 Function Protein binding IPI 9742401, 16273093, 24658140, 28514442, 31980649, 32296183, 33961781
GO:0005654 Component Nucleoplasm IBA
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601099 10902 ENSG00000155926
Protein
UniProt ID Q13239
Protein name Src-like-adapter (Src-like-adapter protein 1) (SLAP-1) (hSLAP)
Protein function Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-c
PDB 2CUD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 29 74 SH3 domain Domain
PF00017 SH2 84 160 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9660183}.
Sequence
MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWK
AISLSTGRESYIPG
ICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFY
SLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHY
SEVADGLCCVLTTPCLTQST
AAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLT
SEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Sequence length 276
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35325730, 38015097
Colorectal Neoplasms Associate 11870500, 15750208
Colorectal Neoplasms Inhibit 24457997
Glioblastoma Associate 17002787
Hepatitis Autoimmune Associate 17006990, 36741403
Leukemia Myeloid Acute Associate 35973983
Lymphoma Large B Cell Diffuse Associate 26869285
Machado Joseph Disease Associate 25914309
Neoplasms Associate 11870500, 15750208, 26869285
Neoplasms Inhibit 24457997