Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6502
Gene name Gene Name - the full gene name approved by the HGNC.	S-phase kinase associated protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SKP2
Synonyms (NCBI Gene) Gene synonyms aliases	FBL1, FBXL1, FLB1, p45
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021626	hsa-miR-142-3p	Microarray	17612493
MIRT030943	hsa-miR-21-5p	Microarray	18591254
MIRT053122	hsa-miR-7-5p	GFP reporter assay	23762407
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT561050	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT358762	hsa-miR-3163	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT408388	hsa-miR-5701	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	qRT-PCR, Luciferase reporter assay, Western blot	25151966
MIRT358762	hsa-miR-3163	Luciferase reporter assay	26482610
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	27292025
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT561050	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT358762	hsa-miR-3163	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT408388	hsa-miR-5701	PAR-CLIP	20371350
MIRT1351300	hsa-miR-105	CLIP-seq
MIRT1351301	hsa-miR-298	CLIP-seq
MIRT1351302	hsa-miR-3678-3p	CLIP-seq
MIRT1351303	hsa-miR-4493	CLIP-seq
MIRT1351304	hsa-miR-4668-5p	CLIP-seq
MIRT1351305	hsa-miR-548a-3p	CLIP-seq
MIRT1351306	hsa-miR-548aa	CLIP-seq
MIRT1351307	hsa-miR-548e	CLIP-seq
MIRT1351308	hsa-miR-548f	CLIP-seq
MIRT2104099	hsa-miR-1587	CLIP-seq
MIRT2104100	hsa-miR-3145-5p	CLIP-seq
MIRT2104101	hsa-miR-338-3p	CLIP-seq
MIRT2104102	hsa-miR-4530	CLIP-seq
MIRT2104103	hsa-miR-4661-5p	CLIP-seq
MIRT2104104	hsa-miR-4674	CLIP-seq
MIRT2104105	hsa-miR-508-5p	CLIP-seq
MIRT2104106	hsa-miR-516a-3p	CLIP-seq
MIRT1351305	hsa-miR-548a-3p	CLIP-seq
MIRT1351307	hsa-miR-548e	CLIP-seq
MIRT1351308	hsa-miR-548f	CLIP-seq
MIRT2104107	hsa-miR-766	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
E2F1	Activation	23352642
E2F1	Unknown	17483325;20424123;23348237;24574749
ELK1	Unknown	16969077
ING4	Repression	18399550
LEF1	Unknown	19174556
MYCN	Repression	17495526
SP1	Activation	19329185
SP1	Unknown	16969077
TCF4	Unknown	19174556
VDR	Repression	16883603
YBX1	Repression	20596676

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	7553852
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA	21873635
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0005515	Function	Protein binding	IPI	11931757, 12504026, 12609982, 12813041, 16209941, 16286470, 16376880, 16880511, 17157259, 18239684, 18805092, 18818696, 21145461, 21856198, 22632967, 22770219, 23911321, 25241761, 27194766, 27542266, 27705803, 28514442, 29997244, 30833792
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019005	Component	SCF ubiquitin ligase complex	IBA	21873635
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	16880511
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	22770219
GO:0042981	Process	Regulation of apoptotic process	IDA	23277542
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	27194766
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045087	Process	Innate immune response	IMP	27194766
GO:0051607	Process	Defense response to virus	IMP	27194766
GO:0051726	Process	Regulation of cell cycle	IBA	21873635
GO:0070936	Process	Protein K48-linked ubiquitination	IMP	27194766

MIM	HGNC	e!Ensembl
601436	10901	ENSG00000145604

Protein

UniProt ID

Q13309

Protein name

S-phase kinase-associated protein 2 (Cyclin-A/CDK2-associated protein p45) (F-box protein Skp2) (F-box/LRR-repeat protein 1) (p45skp2)

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transdu

PDB

1FQV , 1FS1 , 1FS2 , 1LDK , 2ASS , 2AST , 7B5L , 7B5M , 7B5R , 7LUO , 7Z8T , 7Z8V , 7ZBW , 7ZBZ , 8BYA , 8BYL , 8CDJ , 8CDK , 8OR0 , 8OR3 , 8OR4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	97 → 143	F-box-like	Domain

Sequence

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Ubiquitin mediated proteolysis mTOR signaling pathway Epstein-Barr virus infection Pathways in cancer Viral carcinogenesis Small cell lung cancer		APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 SCF(Skp2)-mediated degradation of p27/p21 Ub-specific processing proteases Orc1 removal from chromatin Cyclin D associated events in G1 Regulation of RUNX2 expression and activity Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	18850583
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	19270706
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828 View all (31 more)	19636294

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Coronary artery disease	Coronary artery disease			GWAS

Show/Hide Text Mining Associations (111)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Inhibit	34116705
Adenocarcinoma of Lung	Associate	15700547, 18399550, 22372491, 25333250
Adenoma	Associate	32856866
Arthritis Rheumatoid	Associate	34079550
Autoimmune Diseases	Associate	22855503
Biliary Tract Neoplasms	Stimulate	15596046
Breast Neoplasms	Associate	12208864, 12904306, 16168119, 16859513, 18644126, 20075077, 22431515, 23071779, 23300741, 23939428, 24642627, 26345857, 26694515, 27582552, 28335434 View all (6 more)
Breast Neoplasms	Stimulate	27111245
Calcinosis Cutis	Associate	20883453
Carcinogenesis	Associate	12879424, 19889619, 22310285, 23029392, 23261596, 26046466, 28446188, 34116705, 35301297, 36871351
Carcinoma Endometrioid	Associate	16080017
Carcinoma Hepatocellular	Associate	12883474, 15526362, 19404778, 21704589, 23348237, 25537506, 27779207, 29360760, 29991055, 31426282, 33422101, 33662413, 37679418
Carcinoma Merkel Cell	Associate	35336880
Carcinoma Neuroendocrine	Associate	17471231
Carcinoma Non Small Cell Lung	Associate	15215173, 26482610, 26942878, 27149377
Carcinoma Non Small Cell Lung	Stimulate	17156491, 26505456
Carcinoma Renal Cell	Associate	18922157, 22733130, 24986570, 25120761, 32229735, 36385010
Carcinoma Small Cell	Associate	12107105, 12824902
Carcinoma Squamous Cell	Stimulate	15215173
Carcinoma Squamous Cell	Associate	28377632, 37257769
Cholangiocarcinoma	Associate	24574749, 25663461
Chromosomal Instability	Associate	17457043
Chromosomal Instability	Inhibit	36496990
Colorectal Neoplasms	Associate	15073847, 15717322, 23328995, 28675510, 29135092, 32856866, 34237211, 35301297, 36496990
Craniocerebral Trauma	Associate	16425372
Death	Stimulate	27317767
Diabetes Mellitus	Associate	32965004
Diabetes Mellitus Type 2	Associate	27380896
Disease	Associate	23071715
Dwarfism	Associate	30281379
Dysplastic Nevus Syndrome	Stimulate	21386910
Endometrial Hyperplasia	Associate	16080017
Endometrial Neoplasms	Associate	16080017, 19724954
Epidermolysis bullosa simplex Ogna type	Associate	28675510
Esophageal Neoplasms	Associate	15161026, 28178195, 32360515, 34488675
Esophageal Squamous Cell Carcinoma	Associate	15161026, 19147533, 22533738, 26568291, 34488675
Fibrocartilaginous embolism	Associate	32271397
Gallbladder Neoplasms	Associate	17384652
Gastrointestinal Hemorrhage	Associate	23690967
Gastrointestinal Stromal Tumors	Associate	18474118, 23690967, 25987131
Glioblastoma	Associate	16232199, 31357480, 36997048
Glioma	Associate	26046466, 36997048
Hashimoto Disease	Associate	12890807
Hemangiosarcoma	Associate	17425381
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26598692, 32626765
Hodgkin Disease	Associate	21385932
Intervertebral Disc Degeneration	Inhibit	32271397
Intestinal Diseases	Associate	16425372
Kidney Failure Chronic	Stimulate	15717322
Kidney Neoplasms	Associate	24986570, 25120761
Leukemia	Associate	19657571
Leukemia Lymphocytic Chronic B Cell	Associate	12351407, 25051361
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15833859, 26956626
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	35741710
Leukemia Myeloid Acute	Associate	35370472, 36820913
Liver Neoplasms	Stimulate	25537506
Lung Neoplasms	Associate	12824902, 29377618, 30918250
Lymphatic Metastasis	Stimulate	15215173, 16080017, 19147533
Lymphatic Metastasis	Associate	16080478, 16425372, 22533738
Lymphoma	Associate	11943729, 12351407, 12879424
Lymphoma Extranodal NK T Cell	Associate	20426910
Lymphoma Follicular	Associate	12351407
Lymphoma Large B Cell Diffuse	Associate	12351407, 12879424, 19889619, 22271891
Lymphoma Mantle Cell	Associate	12351407, 18339899
Lymphoma Non Hodgkin	Associate	11943729
Lymphoma T Cell Cutaneous	Associate	29599065
Melanoma	Associate	18716061, 20883453, 23385514, 23792459, 35845132
Melanoma	Stimulate	21386910
Mouth Diseases	Associate	23385514
Multiple Myeloma	Associate	17303695
Nasopharyngeal Carcinoma	Associate	21352698, 32767326, 34293937
Neoplasm Metastasis	Stimulate	17471231
Neoplasm Metastasis	Associate	19147533, 20659261, 22533738, 24986570, 25106448, 29991055, 34414959
Neoplasms	Stimulate	12107105, 15596046, 17201907, 25120761, 26320455
Neoplasms	Associate	12351407, 12393683, 15073847, 15138278, 15161026, 15526362, 15713632, 15717322, 16232199, 18243116, 18272916, 18399550, 18808421, 18922157, 19029817 View all (52 more)
Neoplasms	Inhibit	19657571, 21385932, 24854087, 25537506, 28337249, 36871351
Neoplasms Basal Cell	Associate	18922157
Neuroendocrine Tumors	Associate	17471231
Non Muscle Invasive Bladder Neoplasms	Associate	26932430
Osteoarthritis	Associate	32965004, 33691763
Osteoporosis	Associate	37915040
Osteosarcoma	Associate	28771075, 33578541, 33621206, 39324133
Ovarian Diseases	Associate	26320455, 34116705
Ovarian Neoplasms	Associate	15075339, 21458521, 25106448, 26320455, 28594256, 29410485, 37512088
Pancreatic Neoplasms	Associate	25987041, 32826949, 35286235
Peritoneal Neoplasms	Associate	17201907
Precancerous Conditions	Associate	32856866
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	18618503
Prolactinoma	Associate	27488872
Prostatic Neoplasms	Associate	12188931, 16158921, 16754685, 18628304, 21514447, 21630295, 21677876, 23071779, 24347472, 30885218, 33799604, 34075107, 36871351
Prostatic Neoplasms Castration Resistant	Associate	25271736, 36871351
Prostatitis	Associate	21514447, 21677876
Rectal Neoplasms	Associate	23328995
Retinal Dysplasia	Associate	16425372
Retinoblastoma	Associate	19183342, 25252974
Salivary Gland Neoplasms	Associate	22094872
Sarcoma	Associate	23071715
Sick Sinus Syndrome	Associate	29135092
Small Cell Lung Carcinoma	Associate	12107105, 12824902, 15215173
Squamous Cell Carcinoma of Head and Neck	Associate	16080478, 20659261, 34999279
Squamous Cell Carcinoma of Head and Neck	Stimulate	26874697
Stomach Neoplasms	Associate	16425372, 28446188, 30015872, 34414959, 36609277
Tertiary Lymphoid Structures	Associate	15215173
Thyroid Cancer Papillary	Associate	36694914
Thyroid Neoplasms	Associate	11839571, 36694914
Urethral Neoplasms	Associate	29312470
Urinary Bladder Diseases	Associate	24656158
Urinary Bladder Neck Obstruction	Associate	24656158
Urinary Bladder Neoplasms	Associate	26932430, 36293387
Uterine Cervical Neoplasms	Associate	17311676, 18559093, 27317767
Virus Diseases	Associate	26038816

SKP2 (S-phase kinase associated protein 2)