Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	6502
Gene name	S-phase kinase associated protein 2
Gene symbol	SKP2
Synonyms (NCBI Gene)	FBL1FBXL1FLB1p45
Chromosome	5
Chromosome location	5p13.2
Summary	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021626	hsa-miR-142-3p	Microarray	17612493
MIRT030943	hsa-miR-21-5p	Microarray	18591254
MIRT053122	hsa-miR-7-5p	GFP reporter assay	23762407
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT561050	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT358762	hsa-miR-3163	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT408388	hsa-miR-5701	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	qRT-PCRLuciferase reporter assayWestern blot	25151966
MIRT358762	hsa-miR-3163	Luciferase reporter assay	26482610
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	27292025
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT561050	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT358762	hsa-miR-3163	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT408388	hsa-miR-5701	PAR-CLIP	20371350
MIRT1351300	hsa-miR-105	CLIP-seq
MIRT1351301	hsa-miR-298	CLIP-seq
MIRT1351302	hsa-miR-3678-3p	CLIP-seq
MIRT1351303	hsa-miR-4493	CLIP-seq
MIRT1351304	hsa-miR-4668-5p	CLIP-seq
MIRT1351305	hsa-miR-548a-3p	CLIP-seq
MIRT1351306	hsa-miR-548aa	CLIP-seq
MIRT1351307	hsa-miR-548e	CLIP-seq
MIRT1351308	hsa-miR-548f	CLIP-seq
MIRT2104099	hsa-miR-1587	CLIP-seq
MIRT2104100	hsa-miR-3145-5p	CLIP-seq
MIRT2104101	hsa-miR-338-3p	CLIP-seq
MIRT2104102	hsa-miR-4530	CLIP-seq
MIRT2104103	hsa-miR-4661-5p	CLIP-seq
MIRT2104104	hsa-miR-4674	CLIP-seq
MIRT2104105	hsa-miR-508-5p	CLIP-seq
MIRT2104106	hsa-miR-516a-3p	CLIP-seq
MIRT1351305	hsa-miR-548a-3p	CLIP-seq
MIRT1351307	hsa-miR-548e	CLIP-seq
MIRT1351308	hsa-miR-548f	CLIP-seq
MIRT2104107	hsa-miR-766	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
E2F1	Activation	23352642
E2F1	Unknown	17483325;20424123;23348237;24574749
ELK1	Unknown	16969077
ING4	Repression	18399550
LEF1	Unknown	19174556
MYCN	Repression	17495526
SP1	Activation	19329185
SP1	Unknown	16969077
TCF4	Unknown	19174556
VDR	Repression	16883603
YBX1	Repression	20596676

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	7553852
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000729	Process	DNA double-strand break processing	IDA	15064416, 15790808, 26240375
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	11099048, 11931757, 12504026, 12609982, 12813041, 16209941, 16286470, 16376880, 16865698, 16880511, 17157259, 18239684, 18667692, 18805092, 18818696, 20134482, 20818375, 21119685, 21145461, 21856198, 22632967, 22770219, 23911321, 25241761, 27194766, 27542266, 27705803, 28514442, 299
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	16880511, 22464731
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0042802	Function	Identical protein binding	IPI	22770219
GO:0042981	Process	Regulation of apoptotic process	IDA	23277542
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	27194766
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	27194766
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	27194766
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	22464731
GO:0070534	Process	Protein K63-linked ubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IMP	27194766
GO:0071460	Process	Cellular response to cell-matrix adhesion	IEA
GO:1902916	Process	Positive regulation of protein polyubiquitination	IEA
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	22464731
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IEA
GO:1990166	Process	Protein localization to site of double-strand break	IDA	24534091
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	22464731
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA

MIM	HGNC	e!Ensembl
601436	10901	ENSG00000145604

Q13309

Protein name

S-phase kinase-associated protein 2 (Cyclin-A/CDK2-associated protein p45) (F-box protein Skp2) (F-box/LRR-repeat protein 1) (p45skp2)

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transdu

PDB

1FQV , 1FS1 , 1FS2 , 1LDK , 2ASS , 2AST , 7B5L , 7B5M , 7B5R , 7LUO , 7Z8T , 7Z8V , 7ZBW , 7ZBZ , 8BYA , 8BYL , 8CDJ , 8CDK , 8OR0 , 8OR3 , 8OR4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	97 → 143	F-box-like	Domain

Sequence

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Ubiquitin mediated proteolysis mTOR signaling pathway Epstein-Barr virus infection Pathways in cancer Viral carcinogenesis Small cell lung cancer		APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 SCF(Skp2)-mediated degradation of p27/p21 Ub-specific processing proteases Orc1 removal from chromatin Cyclin D associated events in G1 Regulation of RUNX2 expression and activity Neddylation Antigen processing: Ubiquitination & Proteasome degradation

SKP2 (S-phase kinase associated protein 2)