Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64951
Gene name	Mitochondrial ribosomal protein S24
Gene symbol	MRPS24
Synonyms (NCBI Gene)	HSPC335MRP-S24S24mtbMRP-47bMRP47
Chromosome	7
Chromosome location	7p13
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001615	hsa-let-7b-5p	pSILAC	18668040
MIRT030482	hsa-miR-24-3p	Microarray	19748357
MIRT001615	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT041903	hsa-miR-484	CLASH	23622248
MIRT1160077	hsa-miR-1184	CLIP-seq
MIRT1160078	hsa-miR-1205	CLIP-seq
MIRT1160079	hsa-miR-1260	CLIP-seq
MIRT1160080	hsa-miR-1260b	CLIP-seq
MIRT1160081	hsa-miR-188-3p	CLIP-seq
MIRT1160082	hsa-miR-1910	CLIP-seq
MIRT1160083	hsa-miR-3134	CLIP-seq
MIRT1160084	hsa-miR-3156-3p	CLIP-seq
MIRT1160085	hsa-miR-3158-5p	CLIP-seq
MIRT1160086	hsa-miR-3184	CLIP-seq
MIRT1160087	hsa-miR-361-3p	CLIP-seq
MIRT1160088	hsa-miR-3679-3p	CLIP-seq
MIRT1160089	hsa-miR-3909	CLIP-seq
MIRT1160090	hsa-miR-3921	CLIP-seq
MIRT1160091	hsa-miR-423-5p	CLIP-seq
MIRT1160092	hsa-miR-4264	CLIP-seq
MIRT1160093	hsa-miR-4534	CLIP-seq
MIRT1160094	hsa-miR-455-3p	CLIP-seq
MIRT1160095	hsa-miR-4633-5p	CLIP-seq
MIRT1160096	hsa-miR-4649-3p	CLIP-seq
MIRT1160097	hsa-miR-4653-5p	CLIP-seq
MIRT1160098	hsa-miR-532-5p	CLIP-seq
MIRT1160099	hsa-miR-548v	CLIP-seq
MIRT1160100	hsa-miR-586	CLIP-seq
MIRT1160101	hsa-miR-587	CLIP-seq
MIRT1160102	hsa-miR-662	CLIP-seq
MIRT2275065	hsa-miR-1245b-3p	CLIP-seq
MIRT1160079	hsa-miR-1260	CLIP-seq
MIRT1160080	hsa-miR-1260b	CLIP-seq
MIRT1160081	hsa-miR-188-3p	CLIP-seq
MIRT1160082	hsa-miR-1910	CLIP-seq
MIRT1160084	hsa-miR-3156-3p	CLIP-seq
MIRT1160086	hsa-miR-3184	CLIP-seq
MIRT1160089	hsa-miR-3909	CLIP-seq
MIRT1160090	hsa-miR-3921	CLIP-seq
MIRT1160091	hsa-miR-423-5p	CLIP-seq
MIRT1160092	hsa-miR-4264	CLIP-seq
MIRT2275066	hsa-miR-4272	CLIP-seq
MIRT1160094	hsa-miR-455-3p	CLIP-seq
MIRT1160095	hsa-miR-4633-5p	CLIP-seq
MIRT1160096	hsa-miR-4649-3p	CLIP-seq
MIRT1160097	hsa-miR-4653-5p	CLIP-seq
MIRT2275067	hsa-miR-4712-3p	CLIP-seq
MIRT1160098	hsa-miR-532-5p	CLIP-seq
MIRT1160100	hsa-miR-586	CLIP-seq
MIRT1160102	hsa-miR-662	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	ISS
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	10938081, 25838379
GO:0005840	Component	Ribosome	IEA
GO:0032543	Process	Mitochondrial translation	ISS
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611986	14510	ENSG00000062582

Q96EL2

Protein name

Small ribosomal subunit protein uS3m (28S ribosomal protein S24, mitochondrial) (MRP-S24) (S24mt) (bMRP-47) (bMRP47)

PDB

3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14955	MRP-S24	36 → 167	Mitochondrial ribosome subunit S24	Family

Sequence

MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPH
YIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEIC
AVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL

Sequence length

167

Interactions

View interactions

	Reactome
			Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

MRPS24 (mitochondrial ribosomal protein S24)