Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6494
Gene name	Signal-induced proliferation-associated 1
Gene symbol	SIPA1
Synonyms (NCBI Gene)	SPA1
Chromosome	11
Chromosome location	11q13.1
Summary	The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030296	hsa-miR-26b-5p	Microarray	19088304
MIRT486321	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT486322	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT486320	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT486319	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT486318	hsa-miR-6087	PAR-CLIP	23592263
MIRT486317	hsa-miR-661	PAR-CLIP	23592263
MIRT486316	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT486315	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT486314	hsa-miR-663a	PAR-CLIP	23592263
MIRT486313	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT486312	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT486311	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT486310	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT486308	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT486309	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT486307	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT486306	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT486305	hsa-miR-7704	PAR-CLIP	23592263
MIRT486304	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT486303	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT486302	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT486301	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT486299	hsa-miR-3689c	PAR-CLIP	23592263
MIRT486300	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT486298	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT486321	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT486322	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT486320	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT486319	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT486318	hsa-miR-6087	PAR-CLIP	23592263
MIRT486317	hsa-miR-661	PAR-CLIP	23592263
MIRT486316	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT486315	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT486314	hsa-miR-663a	PAR-CLIP	23592263
MIRT486313	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT486312	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT486311	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT486310	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT486308	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT486309	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT486307	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT486306	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT486305	hsa-miR-7704	PAR-CLIP	23592263
MIRT486304	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT486303	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT486302	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT486301	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT486299	hsa-miR-3689c	PAR-CLIP	23592263
MIRT486300	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT486298	hsa-miR-6780a-5p	PAR-CLIP	23592263

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	TAS
GO:0005096	Function	GTPase activator activity	EXP	16076873
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	NAS	9346962
GO:0005515	Function	Protein binding	IPI	21988832
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007010	Process	Cytoskeleton organization	NAS	12059963
GO:0007162	Process	Negative regulation of cell adhesion	NAS	10373454
GO:0007165	Process	Signal transduction	TAS	9346962
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0030308	Process	Negative regulation of cell growth	NAS	9183624
GO:0032991	Component	Protein-containing complex	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	9346962
GO:0042631	Process	Cellular response to water deprivation	IEA
GO:0045786	Process	Negative regulation of cell cycle	NAS	7799964
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA

MIM	HGNC	e!Ensembl
602180	10885	ENSG00000213445

Q96FS4

Protein name

Signal-induced proliferation-associated protein 1 (Sipa-1) (GTPase-activating protein Spa-1) (p130 SPA-1)

Protein function

GTPase activator for the nuclear Ras-related regulatory proteins Rap1 and Rap2 in vitro, converting them to the putatively inactive GDP-bound state (PubMed:9346962). Affects cell cycle progression (By similarity). {ECO:0000250|UniProtKB:P46062,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02145	Rap_GAP	350 → 533	Rap/ran-GAP	Family
PF00595	PDZ	687 → 759	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal as well as in adult tissues. Expressed abundantly in the lymphoid tissues such as thymus, spleen and peripheral blood lymphocytes and also shows a significant expression in the spinal cord.

Sequence

MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ
EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
ESAATRLLLASKQLGSPTADLA

Sequence length

1042

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Leukocyte transendothelial migration		Rap1 signalling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATORY DISEASE, FAMILIAL, BEHCET-LIKE-3	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar CTD	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	16563182, 19089925, 19765277, 19825179, 23771732, 32193333, 33296812, 33753200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	25352027	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	30146127	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disease	Associate	19906411	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19765277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	34894858	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	19765277, 19906411, 23771732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms Animal	Associate	19765277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	16563182, 19089925, 19765277, 19825179, 19906411, 23771732, 25277657, 25352027, 28362978, 33296812, 37500797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16563182, 23771732, 25352027, 32193333, 33753200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	25277657, 28362978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	34134622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	16563182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Associate	16563182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	28362978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	16563182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	37500797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	19906411	★★★★★ ★☆☆☆☆ Found in Text Mining only

SIPA1 (signal-induced proliferation-associated 1)