Gene Gene information from NCBI Gene database.
Entrez ID 64859
Gene name Nucleic acid binding protein 1
Gene symbol NABP1
Synonyms (NCBI Gene)
NABP1-OT1OBFC2ASOSS-B2SSB2
Chromosome 2
Chromosome location 2q32.3
Summary Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2A, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplie
miRNA miRNA information provided by mirtarbase database.
490
miRTarBase ID miRNA Experiments Reference
MIRT000259 hsa-miR-17-5p Luciferase reporter assay 19734348
MIRT030004 hsa-miR-26b-5p Microarray 19088304
MIRT050058 hsa-miR-26a-5p CLASH 23622248
MIRT086449 hsa-miR-4465 HITS-CLIP 21572407
MIRT030004 hsa-miR-26b-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0000724 Process Double-strand break repair via homologous recombination IDA 19683501
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0000724 Process Double-strand break repair via homologous recombination IMP 19605351
GO:0000781 Component Chromosome, telomeric region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612103 26232 ENSG00000173559
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96AH0
Protein name SOSS complex subunit B2 (Nucleic acid-binding protein 1) (Oligonucleotide/oligosaccharide-binding fold-containing protein 2A) (Sensor of single-strand DNA complex subunit B2) (Sensor of ssDNA subunit B2) (SOSS-B2) (Single-stranded DNA-binding protein 2) (
Protein function Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in part
Family and domains
Sequence
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWD
EIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYR
GQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQ
GTASNQTVMTTISNGRDPRRAFKR
Sequence length 204
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RNA polymerase II transcribes snRNA genes