Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID	64855
Gene name	Niban apoptosis regulator 2
Gene symbol	NIBAN2
Synonyms (NCBI Gene)	C9orf88FAM129BMEG-3MINERVAOC58bA356B19.6
Chromosome	9
Chromosome location	9q34.11

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IDA	17569660
GO:0005515	Function	Protein binding	IPI	19615732, 31262713
GO:0005634	Component	Nucleus	IDA	21148485
GO:0005634	Component	Nucleus	IDA	14602737
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	14602737, 18628527
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21148485
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005912	Component	Adherens junction	IDA	21148485
GO:0005912	Component	Adherens junction	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14602737, 17569660, 20032057, 20179190
GO:0016020	Component	Membrane	IEA
GO:0032274	Process	Gonadotropin secretion	IEP	14602737
GO:0032274	Process	Gonadotropin secretion	IMP	18628527
GO:0043066	Process	Negative regulation of apoptotic process	IMP	21148485
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	17569660
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	17569660, 20032057, 20179190
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	14602737, 17569660, 20032057
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IDA	17569660

MIM	HGNC	e!Ensembl
614045	25282	ENSG00000136830

Q96TA1

Protein name

Protein Niban 2 (Meg-3) (Melanoma invasion by ERK) (MINERVA) (Niban-like protein 1) (Protein FAM129B)

Protein function

May play a role in apoptosis suppression. May promote melanoma cell invasion in vitro.

PDB

7CTP

Family and domains

Sequence

MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLW
RKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSA
GYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQ
DKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNL
VMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPA
MQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKY
DYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSNSGGGG
SPSPSTPESATLSEKRRRAKQVVSVVQDEEVGLPFEASPESPPPASPDGVTEIRGLLAQG
LRPESPPPAGPLLNGAPAGESPQPKAAPEASSPPASPLQHLLPGKAVDLGPPKPSDQETG
EQVSSPSSHPALHTTTEDSAGVQTEF

Sequence length

746

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	26721396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	33428857	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	19362540, 21148485, 33142954, 33684228	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21148485, 26721396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	33142954	★★★★★ ★☆☆☆☆ Found in Text Mining only

NIBAN2 (niban apoptosis regulator 2)