Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64849
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 13 member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC13A3
Synonyms (NCBI Gene) Gene synonyms aliases	ARLIAK, NADC3, NaC3, SDCT2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ARLIAK
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.	Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an impo

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs199961976	T>C	Pathogenic	Intron variant
rs1568904872	C>T	Pathogenic	Coding sequence variant, missense variant
rs1568927501	G>T	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(91)

miRTarBase ID	miRNA	Experiments
MIRT1352473	hsa-miR-1275	CLIP-seq
MIRT1352474	hsa-miR-150	CLIP-seq
MIRT1352475	hsa-miR-3173-3p	CLIP-seq
MIRT1352476	hsa-miR-34b	CLIP-seq
MIRT1352477	hsa-miR-412	CLIP-seq
MIRT1352478	hsa-miR-4257	CLIP-seq
MIRT1352479	hsa-miR-4420	CLIP-seq
MIRT1352480	hsa-miR-4428	CLIP-seq
MIRT1352481	hsa-miR-4477a	CLIP-seq
MIRT1352482	hsa-miR-4477b	CLIP-seq
MIRT1352483	hsa-miR-4488	CLIP-seq
MIRT1352484	hsa-miR-4512	CLIP-seq
MIRT1352485	hsa-miR-4525	CLIP-seq
MIRT1352486	hsa-miR-4665-5p	CLIP-seq
MIRT1352487	hsa-miR-4697-5p	CLIP-seq
MIRT1352488	hsa-miR-4713-5p	CLIP-seq
MIRT1352489	hsa-miR-4723-5p	CLIP-seq
MIRT1352490	hsa-miR-4757-5p	CLIP-seq
MIRT1352491	hsa-miR-532-3p	CLIP-seq
MIRT1352492	hsa-miR-539	CLIP-seq
MIRT1352493	hsa-miR-548a-5p	CLIP-seq
MIRT1352494	hsa-miR-548ab	CLIP-seq
MIRT1352495	hsa-miR-548ak	CLIP-seq
MIRT1352496	hsa-miR-548b-5p	CLIP-seq
MIRT1352497	hsa-miR-548c-5p	CLIP-seq
MIRT1352498	hsa-miR-548d-5p	CLIP-seq
MIRT1352499	hsa-miR-548h	CLIP-seq
MIRT1352500	hsa-miR-548i	CLIP-seq
MIRT1352501	hsa-miR-548j	CLIP-seq
MIRT1352502	hsa-miR-548w	CLIP-seq
MIRT1352503	hsa-miR-548y	CLIP-seq
MIRT1352504	hsa-miR-559	CLIP-seq
MIRT1352505	hsa-miR-625	CLIP-seq
MIRT1352506	hsa-miR-637	CLIP-seq
MIRT1352507	hsa-miR-676	CLIP-seq
MIRT2328800	hsa-miR-128	CLIP-seq
MIRT2328801	hsa-miR-1301	CLIP-seq
MIRT1352474	hsa-miR-150	CLIP-seq
MIRT2328802	hsa-miR-15a	CLIP-seq
MIRT2328803	hsa-miR-15b	CLIP-seq
MIRT2328804	hsa-miR-16	CLIP-seq
MIRT2328805	hsa-miR-195	CLIP-seq
MIRT2328806	hsa-miR-27a	CLIP-seq
MIRT2328807	hsa-miR-27b	CLIP-seq
MIRT2328808	hsa-miR-3156-3p	CLIP-seq
MIRT2328809	hsa-miR-3189-3p	CLIP-seq
MIRT2328810	hsa-miR-424	CLIP-seq
MIRT1352478	hsa-miR-4257	CLIP-seq
MIRT2328811	hsa-miR-4301	CLIP-seq
MIRT2328812	hsa-miR-4468	CLIP-seq
MIRT1352484	hsa-miR-4512	CLIP-seq
MIRT2328813	hsa-miR-4691-3p	CLIP-seq
MIRT1352488	hsa-miR-4713-5p	CLIP-seq
MIRT2328814	hsa-miR-497	CLIP-seq
MIRT2328815	hsa-miR-498	CLIP-seq
MIRT2328816	hsa-miR-5047	CLIP-seq
MIRT2328817	hsa-miR-507	CLIP-seq
MIRT2328818	hsa-miR-513a-5p	CLIP-seq
MIRT1352491	hsa-miR-532-3p	CLIP-seq
MIRT2328819	hsa-miR-543	CLIP-seq
MIRT2328820	hsa-miR-545	CLIP-seq
MIRT2328821	hsa-miR-557	CLIP-seq
MIRT2328801	hsa-miR-1301	CLIP-seq
MIRT1352475	hsa-miR-3173-3p	CLIP-seq
MIRT2459475	hsa-miR-3609	CLIP-seq
MIRT2459476	hsa-miR-3614-5p	CLIP-seq
MIRT2459477	hsa-miR-3670	CLIP-seq
MIRT2459478	hsa-miR-3689d	CLIP-seq
MIRT2459479	hsa-miR-3978	CLIP-seq
MIRT2459480	hsa-miR-4633-3p	CLIP-seq
MIRT2459481	hsa-miR-4690-3p	CLIP-seq
MIRT2328816	hsa-miR-5047	CLIP-seq
MIRT2459482	hsa-miR-548ah	CLIP-seq
MIRT2459483	hsa-miR-890	CLIP-seq
MIRT2459477	hsa-miR-3670	CLIP-seq
MIRT2690866	hsa-miR-1200	CLIP-seq
MIRT2690867	hsa-miR-1207-3p	CLIP-seq
MIRT2328801	hsa-miR-1301	CLIP-seq
MIRT2690868	hsa-miR-2861	CLIP-seq
MIRT2690869	hsa-miR-3178	CLIP-seq
MIRT2690870	hsa-miR-3616-3p	CLIP-seq
MIRT2459477	hsa-miR-3670	CLIP-seq
MIRT2690871	hsa-miR-3944-5p	CLIP-seq
MIRT2690872	hsa-miR-4297	CLIP-seq
MIRT2690873	hsa-miR-4324	CLIP-seq
MIRT2690874	hsa-miR-4486	CLIP-seq
MIRT1352484	hsa-miR-4512	CLIP-seq
MIRT2690875	hsa-miR-4660	CLIP-seq
MIRT2690876	hsa-miR-4721	CLIP-seq
MIRT2328816	hsa-miR-5047	CLIP-seq
MIRT2690877	hsa-miR-544b	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PITX2	Unknown	21873665

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005310	Function	Dicarboxylic acid transmembrane transporter activity	IDA	10992006
GO:0005310	Function	Dicarboxylic acid transmembrane transporter activity	TAS	10992006
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006835	Process	Dicarboxylic acid transport	IDA	10992006
GO:0006835	Process	Dicarboxylic acid transport	TAS	10992006
GO:0015137	Function	Citrate transmembrane transporter activity	IBA	21873635
GO:0015137	Function	Citrate transmembrane transporter activity	ISS
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	30635937
GO:0015141	Function	Succinate transmembrane transporter activity	IBA	21873635
GO:0015141	Function	Succinate transmembrane transporter activity	IDA	10992006, 21264516, 24247155, 26176240, 30635937
GO:0015141	Function	Succinate transmembrane transporter activity	TAS	10992006
GO:0015362	Function	High-affinity sodium:dicarboxylate symporter activity	TAS
GO:0015742	Process	Alpha-ketoglutarate transport	IEA
GO:0015746	Process	Citrate transport	IBA	21873635
GO:0015746	Process	Citrate transport	ISS
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016323	Component	Basolateral plasma membrane	IDA	27053689
GO:0017153	Function	Sodium:dicarboxylate symporter activity	IBA	21873635
GO:0017153	Function	Sodium:dicarboxylate symporter activity	IDA	10992006
GO:0017153	Function	Sodium:dicarboxylate symporter activity	TAS	10992006
GO:0034634	Function	Glutathione transmembrane transporter activity	IDA	24247155
GO:0034775	Process	Glutathione transmembrane transport	IDA	24247155
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071422	Process	Succinate transmembrane transport	IDA	10992006, 21264516, 24247155, 26176240
GO:0071422	Process	Succinate transmembrane transport	TAS	10992006
GO:0098656	Process	Anion transmembrane transport	IBA	21873635
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653

MIM	HGNC	e!Ensembl
606411	14430	ENSG00000158296

Protein

UniProt ID

Q8WWT9

Protein name

Na(+)/dicarboxylate cotransporter 3 (NaDC-3) (hNaDC3) (Na(+)-coupled carboxylate transporter 3) (NaC3) (Sodium-dependent high-affinity dicarboxylate transporter 2) (Solute carrier family 13 member 3) (SLC13A3)

Protein function

High-affinity sodium-dicarboxylate cotransporter that accepts a range of substrates with 4-6 carbon atoms, such as the citric acid cycle intermediates succinate and alpha-ketoglutarate (2-oxoglutarate), as well as other compounds including N-ace

PDB

8UVC , 8UVD , 8UVE , 8UVF , 8UVG , 8UVI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00939	Na_sulph_symp	9 → 573	Sodium:sulfate symporter transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is highest in kidney (PubMed:16331647). Detected in placenta, brain, liver and pancreas. {ECO:0000269|PubMed:16331647}.

Sequence

MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLS
VTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLV
GVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENT
AAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFLISIPY
SASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL
YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRD
PKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK
AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTE
FASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLL
VKDMVRTGLLMNLMGVLLLSLAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFR
TL

Sequence length

602

Interactions

View interactions

	Reactome
			Sodium-coupled sulphate, di- and tri-carboxylate transporters

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Kidney disease	Chronic Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	24351856

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Leukoencephalopathy	leukoencephalopathy, acute reversible, with increased urinary alpha-ketoglutarate	GenCC
Gout	Gout	GWAS
Kidney Disease	Kidney Disease	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Alpha ketoglutarate dehydrogenase deficiency	Associate	37794328
Carcinoma Renal Cell	Associate	26831905, 37657024
Cerebral Infarction	Associate	26352407
Chronic Kidney Diseases of Uncertain Etiology	Associate	24351856
Diabetes Mellitus Type 2	Associate	18602983
Genetic Diseases X Linked	Associate	37794328
Hypertension Pulmonary	Associate	26352407
Intellectual Disability	Associate	37794328
Kidney Failure Chronic	Associate	18602983
Lupus Erythematosus Systemic	Associate	30777133
Osteoarthritis Knee	Associate	30086750
Posterior Leukoencephalopathy Syndrome	Associate	37794328
Renal Insufficiency Chronic	Associate	26352407

SLC13A3 (solute carrier family 13 member 3)