Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64843
Gene name Gene Name - the full gene name approved by the HGNC.
ISL LIM homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ISL2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT490294 hsa-miR-7160-3p PAR-CLIP 23592263
MIRT490293 hsa-miR-7706 PAR-CLIP 23592263
MIRT490292 hsa-miR-1252-5p PAR-CLIP 23592263
MIRT490291 hsa-miR-3195 PAR-CLIP 23592263
MIRT490289 hsa-miR-4533 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609481 18524 ENSG00000159556
Protein
UniProt ID Q96A47
Protein name Insulin gene enhancer protein ISL-2 (Islet-2)
Protein function Transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 27 85 LIM domain Domain
PF00412 LIM 89 145 LIM domain Domain
PF00046 Homeodomain 192 248 Homeodomain Domain
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLF
GIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGL
LLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPAL
RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKK
KSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Sequence length 359
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Pancreatic Ductal Associate 35508175
Pancreatic Neoplasms Associate 35508175