Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6484
Gene name Gene Name - the full gene name approved by the HGNC.	ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ST3GAL4
Synonyms (NCBI Gene) Gene synonyms aliases	CGS23, NANTA3, SAT3, SIAT4, SIAT4C, ST-4, ST3GalA.2, ST3GalIV, STZ, gal-NAc6S
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be invol

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT1393543	hsa-miR-1236	CLIP-seq
MIRT1393544	hsa-miR-1825	CLIP-seq
MIRT1393545	hsa-miR-3163	CLIP-seq
MIRT1393546	hsa-miR-340	CLIP-seq
MIRT1393547	hsa-miR-4796-3p	CLIP-seq
MIRT1393548	hsa-miR-548t	CLIP-seq
MIRT1393544	hsa-miR-1825	CLIP-seq
MIRT2340069	hsa-miR-3183	CLIP-seq
MIRT2340070	hsa-miR-3192	CLIP-seq
MIRT2340071	hsa-miR-326	CLIP-seq
MIRT2340072	hsa-miR-330-5p	CLIP-seq
MIRT2340073	hsa-miR-3616-3p	CLIP-seq
MIRT2340074	hsa-miR-3689a-3p	CLIP-seq
MIRT2340075	hsa-miR-3689c	CLIP-seq
MIRT2340076	hsa-miR-4723-3p	CLIP-seq
MIRT2340077	hsa-miR-4728-5p	CLIP-seq
MIRT2340078	hsa-miR-4749-3p	CLIP-seq
MIRT2340079	hsa-miR-4763-5p	CLIP-seq
MIRT2340080	hsa-miR-516b	CLIP-seq
MIRT2633994	hsa-miR-1226	CLIP-seq
MIRT2633995	hsa-miR-4691-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYC	Activation	22547830

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IBA
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	8288606
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS	8557707
GO:0005576	Component	Extracellular region	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IDA	8288606
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IDA	8611500
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IEA
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IMP	25498912
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	TAS
GO:0009101	Process	Glycoprotein biosynthetic process	IDA	8288606
GO:0009247	Process	Glycolipid biosynthetic process	IBA
GO:0009247	Process	Glycolipid biosynthetic process	IDA	8288606
GO:0009312	Process	Oligosaccharide biosynthetic process	IDA	8288606
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0019082	Process	Viral protein processing	TAS
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030194	Process	Positive regulation of blood coagulation	ISS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0047288	Function	Beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase	IBA
GO:0047288	Function	Beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase	IEA
GO:0050890	Process	Cognition	IMP	23227193
GO:0097503	Process	Sialylation	IDA	8288606
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IMP	25498912

MIM	HGNC	e!Ensembl
104240	10864	ENSG00000110080

Protein

UniProt ID

Q11206

Protein name

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (Alpha 2,3-ST 4) (Beta-galactoside alpha-2,3-sialyltransferase 4) (EC 2.4.3.2) (EC 2.4.3.4) (Alpha 2,3-sialyltransferase IV) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransfer

Protein function

A beta-galactoside alpha2-3 sialyltransferase involved in terminal sialylation of glycoproteins and glycolipids (PubMed:8288606, PubMed:8611500). Catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	69 → 331	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in adult placenta, heart and kidney. {ECO:0000269|PubMed:8288606}.

Sequence

MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFG
NYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRC
VVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVE
NNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIA
ADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQIT
LKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Sequence length

333

Interactions

View interactions

	KEGG		Reactome
	Glycosphingolipid biosynthesis - lacto and neolacto series Metabolic pathways		Keratan sulfate biosynthesis Sialic acid metabolism Lewis blood group biosynthesis N-Glycan antennae elongation Termination of O-glycan biosynthesis

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Leprosy	Leprosy	N/A	N/A	GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Stimulate	35837404
Bornholm Eye Disease	Associate	33922358
Carcinoma Hepatocellular	Associate	17054948
Carcinoma Pancreatic Ductal	Associate	32872308
Colorectal Neoplasms	Associate	10673297
Diabetes Mellitus	Associate	27584569
Gastrointestinal Neoplasms	Associate	37074623
Graves Disease	Associate	31379878
Hypertension	Associate	27584569
Inflammatory Bowel Diseases	Associate	40005516
Irritable Bowel Syndrome	Stimulate	40005516
Lymphoma T Cell Cutaneous	Associate	35850209
Meningioma	Associate	38274327
Mouth Diseases	Associate	24606438
Neoplasm Metastasis	Associate	32872308
Neoplasms	Associate	33627655, 37074623
Osteosarcoma	Associate	35102149, 38212768
Ovarian Neoplasms	Associate	33579350
Status Asthmaticus	Associate	19317339
Stomach Neoplasms	Associate	10835501
Stomach Neoplasms	Stimulate	31695778
Uterine Cervical Diseases	Associate	24606438
Uterine Cervical Neoplasms	Associate	24606438
Uterine Cervicitis	Associate	24606438

ST3GAL4 (ST3 beta-galactoside alpha-2,3-sialyltransferase 4)