Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	6484
Gene name	ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene symbol	ST3GAL4
Synonyms (NCBI Gene)	CGS23NANTA3SAT3SIAT4SIAT4CST-4ST3GalA.2ST3GalIVSTZgal-NAc6S
Chromosome	11
Chromosome location	11q24.2
Summary	This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be invol

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments
MIRT1393543	hsa-miR-1236	CLIP-seq
MIRT1393544	hsa-miR-1825	CLIP-seq
MIRT1393545	hsa-miR-3163	CLIP-seq
MIRT1393546	hsa-miR-340	CLIP-seq
MIRT1393547	hsa-miR-4796-3p	CLIP-seq
MIRT1393548	hsa-miR-548t	CLIP-seq
MIRT1393544	hsa-miR-1825	CLIP-seq
MIRT2340069	hsa-miR-3183	CLIP-seq
MIRT2340070	hsa-miR-3192	CLIP-seq
MIRT2340071	hsa-miR-326	CLIP-seq
MIRT2340072	hsa-miR-330-5p	CLIP-seq
MIRT2340073	hsa-miR-3616-3p	CLIP-seq
MIRT2340074	hsa-miR-3689a-3p	CLIP-seq
MIRT2340075	hsa-miR-3689c	CLIP-seq
MIRT2340076	hsa-miR-4723-3p	CLIP-seq
MIRT2340077	hsa-miR-4728-5p	CLIP-seq
MIRT2340078	hsa-miR-4749-3p	CLIP-seq
MIRT2340079	hsa-miR-4763-5p	CLIP-seq
MIRT2340080	hsa-miR-516b	CLIP-seq
MIRT2633994	hsa-miR-1226	CLIP-seq
MIRT2633995	hsa-miR-4691-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYC	Activation	22547830

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IBA
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	8288606
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS	8557707
GO:0005576	Component	Extracellular region	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IDA	8288606
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IDA	8611500
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IEA
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IMP	25498912
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	TAS
GO:0009101	Process	Glycoprotein biosynthetic process	IDA	8288606
GO:0009247	Process	Glycolipid biosynthetic process	IBA
GO:0009247	Process	Glycolipid biosynthetic process	IDA	8288606
GO:0009312	Process	Oligosaccharide biosynthetic process	IDA	8288606
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0019082	Process	Viral protein processing	TAS
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030194	Process	Positive regulation of blood coagulation	ISS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0047288	Function	Beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase	IBA
GO:0047288	Function	Beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase	IEA
GO:0050890	Process	Cognition	IMP	23227193
GO:0097503	Process	Sialylation	IDA	8288606
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IMP	25498912

MIM	HGNC	e!Ensembl
104240	10864	ENSG00000110080

Q11206

Protein name

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (Alpha 2,3-ST 4) (Beta-galactoside alpha-2,3-sialyltransferase 4) (EC 2.4.3.2) (EC 2.4.3.4) (Alpha 2,3-sialyltransferase IV) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransfer

Protein function

A beta-galactoside alpha2-3 sialyltransferase involved in terminal sialylation of glycoproteins and glycolipids (PubMed:8288606, PubMed:8611500). Catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	69 → 331	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in adult placenta, heart and kidney. {ECO:0000269|PubMed:8288606}.

Sequence

MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFG
NYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRC
VVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVE
NNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIA
ADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQIT
LKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Sequence length

333

Interactions

View interactions

	KEGG		Reactome
	Glycosphingolipid biosynthesis - lacto and neolacto series Metabolic pathways		Keratan sulfate biosynthesis Sialic acid metabolism Lewis blood group biosynthesis N-Glycan antennae elongation Termination of O-glycan biosynthesis

ST3GAL4 (ST3 beta-galactoside alpha-2,3-sialyltransferase 4)