Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64839
Gene name	F-box and leucine rich repeat protein 17
Gene symbol	FBXL17
Synonyms (NCBI Gene)	FBXO13Fbl17Fbx13
Chromosome	5
Chromosome location	5q21.3
Summary	Members of the F-box protein family, such as FBXL17, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030830	hsa-miR-21-5p	Microarray	18591254
MIRT715556	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT715555	hsa-miR-548b-3p	HITS-CLIP	19536157
MIRT715554	hsa-miR-548p	HITS-CLIP	19536157
MIRT715553	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT715556	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT715555	hsa-miR-548b-3p	HITS-CLIP	19536157
MIRT715554	hsa-miR-548p	HITS-CLIP	19536157
MIRT715553	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT715556	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT715555	hsa-miR-548b-3p	HITS-CLIP	19536157
MIRT715554	hsa-miR-548p	HITS-CLIP	19536157
MIRT715553	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT715556	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT715555	hsa-miR-548b-3p	HITS-CLIP	19536157
MIRT715554	hsa-miR-548p	HITS-CLIP	19536157
MIRT715553	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT715556	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT715555	hsa-miR-548b-3p	HITS-CLIP	19536157
MIRT715554	hsa-miR-548p	HITS-CLIP	19536157
MIRT715553	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT990365	hsa-miR-1185	CLIP-seq
MIRT990366	hsa-miR-1227	CLIP-seq
MIRT990367	hsa-miR-1261	CLIP-seq
MIRT990368	hsa-miR-127-5p	CLIP-seq
MIRT990369	hsa-miR-128	CLIP-seq
MIRT990370	hsa-miR-141	CLIP-seq
MIRT990371	hsa-miR-154	CLIP-seq
MIRT990372	hsa-miR-194	CLIP-seq
MIRT990373	hsa-miR-200a	CLIP-seq
MIRT990374	hsa-miR-2682	CLIP-seq
MIRT990375	hsa-miR-28-3p	CLIP-seq
MIRT990376	hsa-miR-3064-3p	CLIP-seq
MIRT990377	hsa-miR-3128	CLIP-seq
MIRT990378	hsa-miR-3145-5p	CLIP-seq
MIRT990379	hsa-miR-320e	CLIP-seq
MIRT990380	hsa-miR-34a	CLIP-seq
MIRT990381	hsa-miR-34c-5p	CLIP-seq
MIRT990382	hsa-miR-3653	CLIP-seq
MIRT990383	hsa-miR-3677-5p	CLIP-seq
MIRT990384	hsa-miR-3679-5p	CLIP-seq
MIRT990385	hsa-miR-3681	CLIP-seq
MIRT990386	hsa-miR-3685	CLIP-seq
MIRT990387	hsa-miR-3691-3p	CLIP-seq
MIRT990388	hsa-miR-384	CLIP-seq
MIRT990389	hsa-miR-409-3p	CLIP-seq
MIRT990390	hsa-miR-4423-3p	CLIP-seq
MIRT990391	hsa-miR-4460	CLIP-seq
MIRT990392	hsa-miR-449a	CLIP-seq
MIRT990393	hsa-miR-449b	CLIP-seq
MIRT990394	hsa-miR-449c	CLIP-seq
MIRT990395	hsa-miR-450b-3p	CLIP-seq
MIRT990396	hsa-miR-4653-3p	CLIP-seq
MIRT990397	hsa-miR-4727-3p	CLIP-seq
MIRT990398	hsa-miR-489	CLIP-seq
MIRT990399	hsa-miR-494	CLIP-seq
MIRT990400	hsa-miR-500a	CLIP-seq
MIRT990401	hsa-miR-515-5p	CLIP-seq
MIRT990402	hsa-miR-548g	CLIP-seq
MIRT990403	hsa-miR-556-3p	CLIP-seq
MIRT990404	hsa-miR-602	CLIP-seq
MIRT990405	hsa-miR-769-3p	CLIP-seq
MIRT990406	hsa-miR-885-3p	CLIP-seq
MIRT990407	hsa-miR-940	CLIP-seq
MIRT1993607	hsa-miR-3121-3p	CLIP-seq
MIRT1993608	hsa-miR-3143	CLIP-seq
MIRT1993609	hsa-miR-3647-3p	CLIP-seq
MIRT1993610	hsa-miR-3941	CLIP-seq
MIRT1993611	hsa-miR-421	CLIP-seq
MIRT1993612	hsa-miR-4435	CLIP-seq
MIRT1993613	hsa-miR-466	CLIP-seq
MIRT1993614	hsa-miR-4672	CLIP-seq
MIRT1993615	hsa-miR-4718	CLIP-seq
MIRT1993616	hsa-miR-4719	CLIP-seq
MIRT1993617	hsa-miR-4731-3p	CLIP-seq
MIRT1993618	hsa-miR-4738-3p	CLIP-seq
MIRT1993619	hsa-miR-4801	CLIP-seq
MIRT1993620	hsa-miR-4803	CLIP-seq
MIRT1993621	hsa-miR-548aa	CLIP-seq
MIRT1993622	hsa-miR-590-3p	CLIP-seq
MIRT1993623	hsa-miR-600	CLIP-seq
MIRT990404	hsa-miR-602	CLIP-seq
MIRT2227357	hsa-miR-125a-3p	CLIP-seq
MIRT2227358	hsa-miR-1324	CLIP-seq
MIRT1993607	hsa-miR-3121-3p	CLIP-seq
MIRT2227359	hsa-miR-3148	CLIP-seq
MIRT2227360	hsa-miR-3194-3p	CLIP-seq
MIRT2227361	hsa-miR-4279	CLIP-seq
MIRT2227362	hsa-miR-4457	CLIP-seq
MIRT2227363	hsa-miR-4668-5p	CLIP-seq
MIRT2227364	hsa-miR-513b	CLIP-seq
MIRT2227365	hsa-miR-552	CLIP-seq
MIRT2227366	hsa-miR-607	CLIP-seq
MIRT2227367	hsa-miR-767-3p	CLIP-seq
MIRT2227368	hsa-miR-891b	CLIP-seq
MIRT2387910	hsa-miR-296-3p	CLIP-seq
MIRT2227362	hsa-miR-4457	CLIP-seq
MIRT2227364	hsa-miR-513b	CLIP-seq
MIRT2227368	hsa-miR-891b	CLIP-seq
MIRT2437224	hsa-miR-1267	CLIP-seq
MIRT2437225	hsa-miR-1270	CLIP-seq
MIRT2437226	hsa-miR-185	CLIP-seq
MIRT2437227	hsa-miR-200b	CLIP-seq
MIRT2437228	hsa-miR-200c	CLIP-seq
MIRT2437229	hsa-miR-30a	CLIP-seq
MIRT2437230	hsa-miR-30b	CLIP-seq
MIRT2437231	hsa-miR-30c	CLIP-seq
MIRT2437232	hsa-miR-30d	CLIP-seq
MIRT2437233	hsa-miR-30e	CLIP-seq
MIRT1993609	hsa-miR-3647-3p	CLIP-seq
MIRT2437234	hsa-miR-429	CLIP-seq
MIRT2437235	hsa-miR-4306	CLIP-seq
MIRT2437236	hsa-miR-452	CLIP-seq
MIRT2437237	hsa-miR-4531	CLIP-seq
MIRT2437238	hsa-miR-4644	CLIP-seq
MIRT2437239	hsa-miR-4676-3p	CLIP-seq
MIRT990398	hsa-miR-489	CLIP-seq
MIRT2437240	hsa-miR-620	CLIP-seq
MIRT2437224	hsa-miR-1267	CLIP-seq
MIRT2437225	hsa-miR-1270	CLIP-seq
MIRT2437226	hsa-miR-185	CLIP-seq
MIRT2437227	hsa-miR-200b	CLIP-seq
MIRT2437228	hsa-miR-200c	CLIP-seq
MIRT1993609	hsa-miR-3647-3p	CLIP-seq
MIRT2437234	hsa-miR-429	CLIP-seq
MIRT2437235	hsa-miR-4306	CLIP-seq
MIRT2437236	hsa-miR-452	CLIP-seq
MIRT2437237	hsa-miR-4531	CLIP-seq
MIRT2437238	hsa-miR-4644	CLIP-seq
MIRT2437239	hsa-miR-4676-3p	CLIP-seq
MIRT990398	hsa-miR-489	CLIP-seq
MIRT2437240	hsa-miR-620	CLIP-seq
MIRT990376	hsa-miR-3064-3p	CLIP-seq
MIRT990395	hsa-miR-450b-3p	CLIP-seq
MIRT990405	hsa-miR-769-3p	CLIP-seq
MIRT2531315	hsa-miR-149	CLIP-seq
MIRT2531316	hsa-miR-3064-5p	CLIP-seq
MIRT2531317	hsa-miR-3140-3p	CLIP-seq
MIRT2531318	hsa-miR-4687-3p	CLIP-seq
MIRT2531319	hsa-miR-4794	CLIP-seq
MIRT2531315	hsa-miR-149	CLIP-seq
MIRT2531316	hsa-miR-3064-5p	CLIP-seq
MIRT2531317	hsa-miR-3140-3p	CLIP-seq
MIRT2531318	hsa-miR-4687-3p	CLIP-seq
MIRT2531319	hsa-miR-4794	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	27234298
GO:0005515	Function	Protein binding	IPI	24035498, 27234298, 27705803, 30190310, 33961781, 35869491
GO:0005634	Component	Nucleus	IDA	24035498, 27234298
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24035498
GO:0005737	Component	Cytoplasm	IEA
GO:0006515	Process	Protein quality control for misfolded or incompletely synthesized proteins	IDA	30190310
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS
GO:0008589	Process	Regulation of smoothened signaling pathway	IMP	27234298
GO:0014033	Process	Neural crest cell differentiation	ISS
GO:0016567	Process	Protein ubiquitination	IDA	24035498, 30190310
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	24035498
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	24035498, 27234298
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	30190310

MIM	HGNC	e!Ensembl
609083	13615	ENSG00000145743

Q9UF56

Protein name

F-box/LRR-repeat protein 17 (F-box and leucine-rich repeat protein 17) (F-box only protein 13)

Protein function

Substrate-recognition component of the SCF(FBXL17) E3 ubiquitin ligase complex, a key component of a quality control pathway required to ensure functional dimerization of BTB domain-containing proteins (dimerization quality control, DQC) (PubMed

PDB

6W66 , 6WCQ , 8UAH , 8UBT , 8UBU , 8UBV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	321 → 368	F-box-like	Domain
PF13516	LRR_6	615 → 639	Leucine Rich repeat	Repeat

Sequence

MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRTPAKVPPQPAAPRSRDCFFRGPCM
LCFIVHSPGAPAPAGPEEEPPLSPPPRDGAYAAASSSQHLARRYAALAAEDCAAAARRFL
LSSAAAAAAAAASASSPASCCKELGLAAAAAWEQQGRSLFLASLGPVRFLGPPAAVQLFR
GPTPSPAELPTPPEMVCKRKGAGVPACTPCKQPRCGGGGCGGGGGGGGGGGPAGGGASPP
RPPDAGCCQAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVRAGGTAPLSAQQQHECGDADC
RESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQ
FWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAY
RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDE
GMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLR
NLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLV
SCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVT
VEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS

Sequence length

701

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Associate	35165267	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Associate	34573389	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	18820369, 24528085, 31560077	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	35165267	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Associate	38302916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	38302916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	31560077	★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXL17 (F-box and leucine rich repeat protein 17)