Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6480
Gene name Gene Name - the full gene name approved by the HGNC.
ST6 beta-galactoside alpha-2,6-sialyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ST6GAL1
Synonyms (NCBI Gene) Gene synonyms aliases
CDw75, SIAT1, ST6GalI, ST6N
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006076 hsa-miR-492 Microarray, qRT-PCR 21319197
MIRT006076 hsa-miR-492 Microarray, qRT-PCR 21319197
MIRT006076 hsa-miR-492 Microarray, qRT-PCR 21319197
MIRT017979 hsa-miR-335-5p Microarray 18185580
MIRT030941 hsa-miR-21-5p Microarray 18591254
Transcription factors
Transcription factor Regulation Reference
POU2F1 Unknown 10814704
SP1 Unknown 10814704
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 20378551
GO:0000139 Component Golgi membrane TAS
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IBA
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IDA 23999306
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
109675 10860 ENSG00000073849
Protein
UniProt ID P15907
Protein name Beta-galactoside alpha-2,6-sialyltransferase 1 (Alpha 2,6-ST 1) (EC 2.4.3.1) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1) (ST6Gal I) (ST6GalI) (Sialyltransferase 1)
Protein function Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates. In B lymphocytes, generates neuraminidase-sensitive lymphocyte cell-surface differentiation antigens, such as CDw75, HB-6 and CD76 (PubMed:1730763). {ECO:000
PDB 4JS1 , 4JS2 , 6QVS , 6QVT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00777 Glyco_transf_29 157 386 Glycosyltransferase family 29 (sialyltransferase) Family
Sequence
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGT
DEDIYLLGKATLPGFRTIHC
Sequence length 406
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
  Sialic acid metabolism
N-Glycan antennae elongation
Termination of O-glycan biosynthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 14507929
Asthma Associate 30730306
Astrocytoma Associate 33836687
Breast Neoplasms Associate 12841680, 25344606, 35676533
Breast Neoplasms Stimulate 27588482
Carcinogenesis Associate 23358684, 25465919
Carcinoma Stimulate 23358684
Carcinoma Basal Cell Associate 23549466
Carcinoma Hepatocellular Associate 12429811, 24255131, 27340870, 34559939
Carcinoma Hepatocellular Stimulate 27588482