Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64798
Gene name Gene Name - the full gene name approved by the HGNC.
DEP domain containing MTOR interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DEPTOR
Synonyms (NCBI Gene) Gene synonyms aliases
DEP.6, DEPDC6, hDEPTOR
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.12
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT518506 hsa-miR-4803 HITS-CLIP 21572407
MIRT518504 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT518503 hsa-miR-654-3p HITS-CLIP 21572407
MIRT518502 hsa-miR-4796-5p HITS-CLIP 21572407
MIRT518501 hsa-miR-190a-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IDA 28890335
GO:0004860 Function Protein kinase inhibitor activity IDA 22017875, 22017876, 22017877, 25936805, 34519268, 34519269
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005096 Function GTPase activator activity IBA
GO:0005515 Function Protein binding IPI 19446321, 25416956, 30080879, 30232230, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612974 22953 ENSG00000155792
Protein
UniProt ID Q8TB45
Protein name DEP domain-containing mTOR-interacting protein (hDEPTOR) (DEP domain-containing protein 6)
Protein function Negative regulator of the mTORC1 and mTORC2 complexes: inhibits the protein kinase activity of MTOR, thereby inactivating both complexes (PubMed:19446321, PubMed:22017875, PubMed:22017876, PubMed:22017877, PubMed:25936805, PubMed:29382726, PubMe
PDB 7DKL , 7OWG , 7PE7 , 7PE8 , 7PE9 , 7PEA , 7PEB , 7PEC , 7PED
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00610 DEP 48 117 Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) Domain
PF00610 DEP 148 217 Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) Domain
Sequence
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRF
RKD
DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQF
RMNFRRRRRLMELLNEKSPSSQE
THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
AAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC
Sequence length 409
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Autophagy - animal
mTOR signaling pathway
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Pulmonary Fibrosis Idiopathic pulmonary fibrosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32998690
Alzheimer Disease Inhibit 25119265
Alzheimer disease type 1 Inhibit 25119265
Autoimmune Diseases Associate 28349073, 29940800
Breast Neoplasms Associate 33995662
Breast Neoplasms Inhibit 39945739
Carcinogenesis Associate 26992219
Carcinoma Endometrioid Inhibit 28358054
Carcinoma Hepatocellular Associate 34634301
Carcinoma Pancreatic Ductal Inhibit 25544749