Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64788
Gene name Gene Name - the full gene name approved by the HGNC.
Lipase maturation factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LMF1
Synonyms (NCBI Gene) Gene synonyms aliases
C16orf26, HMFN1876, JFP11, TMEM112, TMEM112A
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121909397 G>A,C Pathogenic Non coding transcript variant, synonymous variant, coding sequence variant, stop gained
rs587777626 C>T Pathogenic Stop gained, intron variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT036691 hsa-miR-935 CLASH 23622248
MIRT1111505 hsa-miR-1207-5p CLIP-seq
MIRT1111506 hsa-miR-1254 CLIP-seq
MIRT1111507 hsa-miR-144 CLIP-seq
MIRT1111508 hsa-miR-2861 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006486 Process Protein glycosylation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611761 14154 ENSG00000103227
Protein
UniProt ID Q96S06
Protein name Lipase maturation factor 1 (Transmembrane protein 112)
Protein function Involved in the maturation of specific proteins in the endoplasmic reticulum. Required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway. Each LMF1 molecule chaperones 50 or more molecules of LPL. {ECO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06762 LMF1 169 380 Lipase maturation factor Family
PF06762 LMF1 359 549 Lipase maturation factor Family
Sequence
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKAL
AFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWS
DMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLET
GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDF
HYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQA
VLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPR
FG
SVVRRAANVSLGVLLAWLSV
PVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVI
LQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWI
IHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRI
GAYFPPLSL
EELRPYFRDRGWPLPGPL
Sequence length 567
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Assembly of active LPL and LIPC lipase complexes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Glioma Glioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 36829221
Colorectal Neoplasms Associate 31442207
Glioma Associate 36541697
Hyperlipidemias Associate 24646025
Hyperlipoproteinemia Type I Associate 19820022, 29288010, 29748148, 32375710, 39537501
Hypertriglyceridemia Associate 19820022, 22135386, 23151256, 29910226, 29921298, 30172716, 30885219, 32115487, 32264896, 35741823, 36613909, 36689289, 38346769, 39278772, 39537501
Obesity Associate 30885219
Pancreatitis Associate 19820022, 30885219, 32264896, 38346769
Severe Acute Respiratory Syndrome Associate 39278772