Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64784
Gene name Gene Name - the full gene name approved by the HGNC.
CREB regulated transcription coactivator 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRTC3
Synonyms (NCBI Gene) Gene synonyms aliases
TORC-3, TORC3
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q26.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023199 hsa-miR-124-3p Microarray 18668037
MIRT025919 hsa-miR-7-5p Microarray 19073608
MIRT049715 hsa-miR-92a-3p CLASH 23622248
MIRT039296 hsa-miR-671-5p CLASH 23622248
MIRT691025 hsa-miR-6768-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IBA
GO:0005515 Function Protein binding IPI 20936779, 28514442, 30611118, 32296183, 33961781, 35271311, 36931259, 39251607
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608986 26148 ENSG00000140577
Protein
UniProt ID Q6UUV7
Protein name CREB-regulated transcription coactivator 3 (Transducer of regulated cAMP response element-binding protein 3) (TORC-3) (Transducer of CREB protein 3)
Protein function Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts indep
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12884 TORC_N 11 81 Transducer of regulated CREB activity, N terminus Family
PF12885 TORC_M 159 321 Transducer of regulated CREB activity middle domain Family
PF12886 TORC_C 545 619 Transducer of regulated CREB activity, C terminus Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach. {ECO:0000269|P
Sequence
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHG
GSLPNVSQLRSSASEFQPSFH
QADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDG
SAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYG
GGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGR
PRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSM
SVGNSVNNIPAAMTHLGIRSS
SGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASAL
HPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQ
SDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSN
CGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSD
SSMGLLDPSVEETFRADRL
Sequence length 619
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Human T-cell leukemia virus 1 infection   Transcriptional activation of mitochondrial biogenesis
Circadian Clock
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acrospiroma Associate 29079171
Acute Coronary Syndrome Associate 29979427
Breast Neoplasms Associate 29559730
Carcinoma Mucoepidermoid Associate 19749740, 23035786, 28438292, 33878706, 36366450
Cardiomyopathy infantile histiocytoid Associate 33878706
Colorectal Neoplasms Associate 33411955
Crohn Disease Associate 26937622
Inflammatory Bowel Diseases Associate 26937622
Lung Neoplasms Associate 32648197
Melanoma Associate 33741716