ILRUN (inflammation and lipid regulator with UBA-like and NBR1-like domains)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 64771
Gene name Inflammation and lipid regulator with UBA-like and NBR1-like domains
Gene symbol ILRUN
Synonyms (NCBI Gene)
C6orf106FP852dJ391O22.4
Chromosome 6
Chromosome location 6p21.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene Gene ontology Other IDs Protein
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0000407 Component Phagophore assembly site IBA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 29802199
GO:0005634 Component Nucleus IDA 29802199
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
612217 21215 ENSG00000196821
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H6K1
Protein name Protein ILRUN (Inflammation and lipid regulator with UBA-like and NBR1-like domains protein)
Protein function Negative regulator of innate antiviral response. Blocks IRF3-dependent cytokine production such as IFNA, IFNB and TNF (PubMed:29802199). Interacts with IRF3 and inhibits IRF3 recruitment to type I IFN promoter sequences while also reducing nucle
PDB 6VHI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14555 UBA_4 25 → 68 Domain
PF16158 N_BRCA1_IG 82 → 179 Ig-like domain from next to BRCA1 gene Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung (at protein level). {ECO:0000269|PubMed:25736925}.
Sequence 
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGG
DQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISK
NTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
Sequence length 298
Interactions View interactions