ILRUN (inflammation and lipid regulator with UBA-like and NBR1-like domains)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64771
Gene name Gene Name - the full gene name approved by the HGNC.
Inflammation and lipid regulator with UBA-like and NBR1-like domains
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ILRUN
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf106, FP852, dJ391O22.4
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0000407 Component Phagophore assembly site IBA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 29802199
GO:0005634 Component Nucleus IDA 29802199
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
612217 21215 ENSG00000196821
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9H6K1
Protein name Protein ILRUN (Inflammation and lipid regulator with UBA-like and NBR1-like domains protein)
Protein function Negative regulator of innate antiviral response. Blocks IRF3-dependent cytokine production such as IFNA, IFNB and TNF (PubMed:29802199). Interacts with IRF3 and inhibits IRF3 recruitment to type I IFN promoter sequences while also reducing nucle
PDB 6VHI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14555 UBA_4 25 → 68 Domain
PF16158 N_BRCA1_IG 82 → 179 Ig-like domain from next to BRCA1 gene Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung (at protein level). {ECO:0000269|PubMed:25736925}.
Sequence 
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGG
DQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISK
NTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
Sequence length 298
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (14)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Gastroesophageal Reflux Disease Gastroesophageal reflux disease N/A N/A GWAS
Show/Hide Text Mining Associations (15)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 25953261
Carcinoma Ductal Stimulate 25953261
Carcinoma Ductal Breast Stimulate 25953261
Carcinoma Non Small Cell Lung Stimulate 25736925
Coronary Disease Associate 37964352
COVID 19 Associate 37964352
Idiopathic Pulmonary Fibrosis Associate 38035073
Leukemia Prolymphocytic T Cell Associate 28165464
Lung Neoplasms Associate 25736925
Lymphatic Metastasis Stimulate 25736925