Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64757
Gene name Gene Name - the full gene name approved by the HGNC.	Mitochondrial amidoxime reducing component 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MTARC1
Synonyms (NCBI Gene) Gene synonyms aliases	MARC1, MOSC1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q41

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	20861021
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0006809	Process	Nitric oxide biosynthetic process	IDA	24500710
GO:0008940	Function	Nitrate reductase activity	IBA
GO:0008940	Function	Nitrate reductase activity	IDA	20861021
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016661	Function	Oxidoreductase activity, acting on other nitrogenous compounds as donors	IDA	25713076
GO:0030151	Function	Molybdenum ion binding	IBA
GO:0030151	Function	Molybdenum ion binding	IDA	20861021, 30397129
GO:0030151	Function	Molybdenum ion binding	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0042126	Process	Nitrate metabolic process	IBA
GO:0042126	Process	Nitrate metabolic process	IDA	20861021
GO:0043546	Function	Molybdopterin cofactor binding	IBA
GO:0043546	Function	Molybdopterin cofactor binding	IDA	20861021, 30397129
GO:0046872	Function	Metal ion binding	IEA
GO:0050421	Function	Nitrite reductase (NO-forming) activity	IDA	24500710
GO:0051410	Process	Detoxification of nitrogen compound	NAS	20861021
GO:0070458	Process	Cellular detoxification of nitrogen compound	IMP	25713076
GO:0098809	Function	Nitrite reductase activity	IDA	24500710
GO:1903958	Component	Nitric-oxide synthase complex	IDA	24500710

MIM	HGNC	e!Ensembl
614126	26189	ENSG00000186205

Protein

UniProt ID

Q5VT66

Protein name

Mitochondrial amidoxime-reducing component 1 (mARC1) (EC 1.7.-.-) (Molybdenum cofactor sulfurase C-terminal domain-containing protein 1) (MOSC domain-containing protein 1) (Moco sulfurase C-terminal domain-containing protein 1)

Protein function

Catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles (PubMed:19053771, PubMed:21029045, PubMed:30397129). As a component of prodrug-converting syst

PDB

6FW2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03476	MOSC_N	55 → 176	MOSC N-terminal beta barrel domain	Domain
PF03473	MOSC	202 → 333	MOSC domain	Domain

Sequence

MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQ
LWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCD
GDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRL
VHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPN
IVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ

Sequence length

337

Interactions

View interactions

	Reactome
			Phase I - Functionalization of compounds

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cirrhosis	Cirrhosis	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Diabetes Mellitus	Associate	34258604
Fatty Liver	Associate	32282858, 35411667
Fibrosis	Associate	32282858, 32720691, 34258604, 36280732, 36555467
Hepatitis Autoimmune	Associate	34949757
Hypertriglyceridemia	Associate	36233117
Immunologic Deficiency Syndromes	Associate	32282858
Liver Cirrhosis	Associate	36555467, 40650184
Liver Diseases	Associate	32282858, 34258604, 36555467, 37686209, 40650184
Liver Diseases	Inhibit	36555467
Liver Failure	Associate	34258604, 34949757
Liver Failure	Inhibit	36555467
Non alcoholic Fatty Liver Disease	Associate	34258604, 35411667, 36280732
Non alcoholic Fatty Liver Disease	Inhibit	36555467
Obesity	Associate	34258604
Pneumonia Lipid	Associate	36233117

MTARC1 (mitochondrial amidoxime reducing component 1)