PLPPR2 (phospholipid phosphatase related 2)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64748
Gene name Gene Name - the full gene name approved by the HGNC.
Phospholipid phosphatase related 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLPPR2
Synonyms (NCBI Gene) Gene synonyms aliases
LPPR2, PRG4
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0006644 Process Phospholipid metabolic process IBA
GO:0006644 Process Phospholipid metabolic process IEA
GO:0007165 Process Signal transduction IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
619591 29566 ENSG00000105520
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96GM1
Protein name Phospholipid phosphatase-related protein type 2 (Inactive phospholipid phosphatase PLPPR2) (Lipid phosphate phosphatase-related protein type 2) (Plasticity-related gene 4 protein) (PRG-4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 129 → 289 PAP2 superfamily Family
Sequence 
MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSTYAKPY
PGPEAASRVPPALVYALVTAGPTLTILLGELARAFFPAPPSAVPVIGESTIVSGACCRFS
PPVRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCLPPSPDRPG
PDRFVTDQGACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL
CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPPSGRRLSP
WEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT
Sequence length 343
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Lysosphingolipid and LPA receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 25803781
COVID 19 Associate 35657140