NUCKS1 (nuclear casein kinase and cyclin dependent kinase substrate 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 64710
Gene name Nuclear casein kinase and cyclin dependent kinase substrate 1
Gene symbol NUCKS1
Synonyms (NCBI Gene)
JC7NUCKS
Chromosome 1
Chromosome location 1q32.1
Summary This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals,
miRNA miRNA information provided by mirtarbase database.
2318
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (2318)
miRTarBase ID miRNA Experiments Reference
MIRT021020 hsa-miR-155-5p Proteomics 18668040
MIRT024393 hsa-miR-215-5p Microarray 19074876
MIRT025293 hsa-miR-34a-5p Proteomics 21566225
MIRT025293 hsa-miR-34a-5p Proteomics 21566225
MIRT026814 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (43)
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0000724 Process Double-strand break repair via homologous recombination IMP 26323318
GO:0000785 Component Chromatin IDA 26323318
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
611912 29923 ENSG00000069275
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H1E3
Protein name Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 (P1)
Protein function Chromatin-associated protein involved in DNA repair by promoting homologous recombination (HR) (PubMed:26323318). Binds double-stranded DNA (dsDNA) and secondary DNA structures, such as D-loop structures, but with less affinity than RAD51AP1 (Pu
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung. {ECO:0000269|PubMed:15381070}.
Sequence 
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSED
SEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEE
DEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTP
SPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPS
GED
Sequence length 243
Interactions View interactions