NUCKS1 (nuclear casein kinase and cyclin dependent kinase substrate 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64710
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear casein kinase and cyclin dependent kinase substrate 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NUCKS1
Synonyms (NCBI Gene) Gene synonyms aliases
JC7, NUCKS
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals,
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2318)
miRTarBase ID miRNA Experiments Reference
MIRT021020 hsa-miR-155-5p Proteomics 18668040
MIRT024393 hsa-miR-215-5p Microarray 19074876
MIRT025293 hsa-miR-34a-5p Proteomics 21566225
MIRT025293 hsa-miR-34a-5p Proteomics 21566225
MIRT026814 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(43)
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0000724 Process Double-strand break repair via homologous recombination IMP 26323318
GO:0000785 Component Chromatin IDA 26323318
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611912 29923 ENSG00000069275
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9H1E3
Protein name Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 (P1)
Protein function Chromatin-associated protein involved in DNA repair by promoting homologous recombination (HR) (PubMed:26323318). Binds double-stranded DNA (dsDNA) and secondary DNA structures, such as D-loop structures, but with less affinity than RAD51AP1 (Pu
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung. {ECO:0000269|PubMed:15381070}.
Sequence 
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSED
SEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEE
DEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTP
SPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPS
GED
Sequence length 243
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Parkinson Disease Parkinson's disease N/A N/A GWAS
Show/Hide Text Mining Associations (35)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 30040709
Bipolar Disorder Associate 29745862
Breast Neoplasms Stimulate 20069058
Breast Neoplasms Associate 24568505, 35069784
Carcinogenesis Associate 24819170, 37528150
Carcinoma Basal Cell Associate 25119009
Carcinoma Ductal Breast Associate 20069058
Carcinoma Squamous Cell Associate 24819170
Colorectal Neoplasms Associate 35698305
Depressive Disorder Associate 23064081