Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	647087
Gene name	Short transmembrane mitochondrial protein 1
Gene symbol	STMP1
Synonyms (NCBI Gene)	C7orf73Mm47MtlbnPL-5283
Chromosome	7
Chromosome location	7q33

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT624506	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT624505	hsa-miR-4641	HITS-CLIP	23824327
MIRT624504	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT526304	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT526303	hsa-miR-6507-5p	PAR-CLIP	22012620
MIRT526302	hsa-miR-1283	PAR-CLIP	22012620
MIRT526301	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT526300	hsa-miR-187-5p	PAR-CLIP	22012620
MIRT480304	hsa-miR-508-5p	PAR-CLIP	23446348
MIRT480303	hsa-miR-3664-5p	PAR-CLIP	23446348
MIRT480302	hsa-miR-5586-3p	PAR-CLIP	23446348
MIRT480301	hsa-miR-759	PAR-CLIP	23446348
MIRT480300	hsa-miR-922	PAR-CLIP	23446348
MIRT480298	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT480299	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT480297	hsa-miR-766-3p	PAR-CLIP	23446348
MIRT480296	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT480295	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT480294	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT480293	hsa-miR-612	PAR-CLIP	23446348
MIRT480292	hsa-miR-6860	PAR-CLIP	23446348
MIRT480291	hsa-miR-4522	PAR-CLIP	23446348
MIRT480290	hsa-miR-873-3p	PAR-CLIP	23446348
MIRT480289	hsa-miR-661	PAR-CLIP	23446348
MIRT480288	hsa-miR-6721-5p	PAR-CLIP	23446348
MIRT480287	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT480286	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT524627	hsa-miR-3672	PAR-CLIP	23446348
MIRT524626	hsa-miR-6864-3p	PAR-CLIP	23446348
MIRT480285	hsa-miR-4688	PAR-CLIP	23446348
MIRT480284	hsa-miR-6510-3p	PAR-CLIP	23446348
MIRT524625	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT524624	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT524623	hsa-miR-940	PAR-CLIP	23446348
MIRT524622	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT524621	hsa-miR-1827	PAR-CLIP	23446348
MIRT524620	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT524619	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT524618	hsa-miR-3612	PAR-CLIP	23446348
MIRT524617	hsa-miR-650	PAR-CLIP	23446348
MIRT524615	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT524616	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT524614	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT480304	hsa-miR-508-5p	PAR-CLIP	23592263
MIRT480303	hsa-miR-3664-5p	PAR-CLIP	23592263
MIRT480302	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT480301	hsa-miR-759	PAR-CLIP	23592263
MIRT480300	hsa-miR-922	PAR-CLIP	23592263
MIRT480298	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT480299	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT480297	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT480296	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT480295	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT480294	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT480293	hsa-miR-612	PAR-CLIP	23592263
MIRT480292	hsa-miR-6860	PAR-CLIP	23592263
MIRT480291	hsa-miR-4522	PAR-CLIP	23592263
MIRT480290	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT480289	hsa-miR-661	PAR-CLIP	23592263
MIRT480288	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT480287	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT480286	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT480285	hsa-miR-4688	PAR-CLIP	23592263
MIRT480284	hsa-miR-6510-3p	PAR-CLIP	23592263

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	IDA	35450818
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005758	Component	Mitochondrial intermembrane space	ISS
GO:0016020	Component	Membrane	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0033617	Process	Mitochondrial cytochrome c oxidase assembly	IMP	35450818
GO:0034551	Process	Mitochondrial respiratory chain complex III assembly	IEA
GO:0034551	Process	Mitochondrial respiratory chain complex III assembly	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0097250	Process	Mitochondrial respirasome assembly	IEA
GO:0097250	Process	Mitochondrial respirasome assembly	IMP	35450818
GO:0098803	Component	Respiratory chain complex	IBA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS

MIM	HGNC	e!Ensembl
618755	41909	ENSG00000243317

E0CX11

Protein name

Short transmembrane mitochondrial protein 1

Protein function

Microprotein involved in mitochondrial respiratory chain complex III (ubiquinol-cytochrome c oxidoreductase) and complex IV (mitochondrial cytochrome c oxidase complex) assembly (PubMed:35450818). Required for the formation of mitochondrial supe

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15054	DUF4535	4 → 44	Domain of unknown function (DUF4535)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in monocytes and dendritic cells. {ECO:0000269|PubMed:31836654}.

Sequence

MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA

Sequence length

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

STMP1 (short transmembrane mitochondrial protein 1)