Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64693
Gene name	Cutaneous T cell lymphoma-associated antigen 1
Gene symbol	CTAGE1
Synonyms (NCBI Gene)	CT21.1CT21.2CTAGECTAGE-1CTAGE-2
Chromosome	18
Chromosome location	18q11.2

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments
MIRT913636	hsa-miR-1283	CLIP-seq
MIRT913637	hsa-miR-1343	CLIP-seq
MIRT913638	hsa-miR-140-3p	CLIP-seq
MIRT913639	hsa-miR-23a	CLIP-seq
MIRT913640	hsa-miR-23b	CLIP-seq
MIRT913641	hsa-miR-23c	CLIP-seq
MIRT913642	hsa-miR-3618	CLIP-seq
MIRT913643	hsa-miR-3662	CLIP-seq
MIRT913644	hsa-miR-4646-5p	CLIP-seq
MIRT913645	hsa-miR-4729	CLIP-seq
MIRT913646	hsa-miR-520d-5p	CLIP-seq
MIRT913647	hsa-miR-524-5p	CLIP-seq
MIRT913648	hsa-miR-561	CLIP-seq
MIRT913649	hsa-miR-934	CLIP-seq
MIRT1970914	hsa-miR-410	CLIP-seq
MIRT1970915	hsa-miR-548k	CLIP-seq
MIRT2206713	hsa-miR-1299	CLIP-seq
MIRT2206714	hsa-miR-142-5p	CLIP-seq
MIRT2206715	hsa-miR-15a	CLIP-seq
MIRT2206716	hsa-miR-15b	CLIP-seq
MIRT2206717	hsa-miR-16	CLIP-seq
MIRT2206718	hsa-miR-195	CLIP-seq
MIRT2206719	hsa-miR-214	CLIP-seq
MIRT913639	hsa-miR-23a	CLIP-seq
MIRT913640	hsa-miR-23b	CLIP-seq
MIRT913641	hsa-miR-23c	CLIP-seq
MIRT913642	hsa-miR-3618	CLIP-seq
MIRT2206720	hsa-miR-3619-5p	CLIP-seq
MIRT1970914	hsa-miR-410	CLIP-seq
MIRT2206721	hsa-miR-424	CLIP-seq
MIRT2206722	hsa-miR-4291	CLIP-seq
MIRT2206723	hsa-miR-4690-5p	CLIP-seq
MIRT2206724	hsa-miR-4764-5p	CLIP-seq
MIRT2206725	hsa-miR-4782-5p	CLIP-seq
MIRT2206726	hsa-miR-497	CLIP-seq
MIRT2206727	hsa-miR-516b	CLIP-seq
MIRT2206728	hsa-miR-548t	CLIP-seq
MIRT913648	hsa-miR-561	CLIP-seq
MIRT2206729	hsa-miR-761	CLIP-seq
MIRT2206730	hsa-miR-922	CLIP-seq
MIRT913649	hsa-miR-934	CLIP-seq
MIRT2447742	hsa-miR-1279	CLIP-seq
MIRT2447743	hsa-miR-3158-3p	CLIP-seq
MIRT2447744	hsa-miR-4446-3p	CLIP-seq
MIRT913645	hsa-miR-4729	CLIP-seq
MIRT2447745	hsa-miR-4773	CLIP-seq
MIRT2447746	hsa-miR-4793-5p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0009306	Process	Protein secretion	IBA
GO:0016020	Component	Membrane	IEA
GO:0035459	Process	Vesicle cargo loading	IBA
GO:0070971	Component	Endoplasmic reticulum exit site	IBA

MIM	HGNC	e!Ensembl
608856	24346	ENSG00000212710

Q96RT6

Protein name

cTAGE family member 2 (Protein cTAGE-2) (Cancer/testis antigen 21.2) (CT21.2)

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Testis. Not found in tumor.

Sequence

MRPDSHPYGFPWELVIRAAVAGFFAVLFLWRSFRSVTSRLYVRREKKFAVALSGLIEEKC
KLLEKFSLVQKEYEGYEVESSLKNASFEKEATEAQSLEATCEKLNRFNSELVHEILCLEK
ELKEEKSKHSEQNELMADISKRIQSLEDESKSLKSQVAEAKMTFKRFQANEERLEIEIQD
AWKENSELQESQKQLLQEAEVWKEQVSELIKQKRTFEDSKVHAEQVLNDKENHIKTLTER
LLKMKDGVAMLEEDVTDDDNLELEMNSESEDGAYLDNPPKGALKKLIHAAKLNASLKTLE
GERNQIYIQLSEVDKTKEELTEHIKNLQTEQASLQSENTHFESENQKLQQKLKVMTELYQ
ENEMKLYRKLIVEEKCRLEKEEKLSKVDEMISHATEELETYRKRAKDLKEFEKTIHFYQK
KIILHEKKAHDNWSAAWTAERNLNDLRKENAHNRQKLTEIEFKIKLLEKDPYGLDVPNTA
FGRQHSPYGPSPLGWPSSETRASLYPPTLLEGPLRLSPLLPRGGGRGSRGPGNPPDHQIT
KERGESSCDRLTDPHRAPSDAGPLAPPWEQDYRMMFPPPGQSYPDSALPPQRQDRFYSNC
ARLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDNLGNLKVPDSSLPAENEATGPGF
VPPPLAPIRGLLFPVDTRGPFIRRGPPFPPPPPGTVFGASPDYFSPRDVPGPPRAPFAMR
NVYLPRGFLPYRPPRPAFFPPAPTF

Sequence length

745

Q9HC47

Protein name

Cutaneous T-cell lymphoma-associated antigen 1 (Protein cTAGE-1) (Cancer/testis antigen 21.1) (CT21.1)

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Testis. Expressed in several cutaneous T-cell lymphoma (CTCL) cell lines, in head-neck carcinomas and carcinoma of ovarian tissues. {ECO:0000269|PubMed:11149944}.

Sequence

MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCS
AFLLLWQGEGVNLR

Sequence length

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BENIGN PROSTATIC HYPERPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	12839582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	25120790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	12839582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fahr's disease	Associate	17917073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Associate	11149944, 12839582, 24850846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	12839582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11149944, 12839582, 16929165	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	12839582	★★★★★ ★☆☆☆☆ Found in Text Mining only

CTAGE1 (cutaneous T cell lymphoma-associated antigen 1)