ZAR1L (zygote arrest 1 like)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 646799
Gene name Zygote arrest 1 like
Gene symbol ZAR1L
Synonyms (NCBI Gene)
Z3CXXC7ZAR2
Chromosome 13
Chromosome location 13q13.1
Summary This gene encodes a member of the ZAR1 family that is predominantly expressed in oocytes and early embryos. The protein may function as an RNA regulator in early embryos. [provided by RefSeq, Apr 2010]
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT2150810 hsa-miR-224 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0001556 Process Oocyte maturation IEA
GO:0001556 Process Oocyte maturation ISS
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
620424 37116 ENSG00000189167
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NP61
Protein name Protein ZAR1-like (Zygote arrest protein 1-like)
Protein function mRNA-binding protein required for maternal mRNA storage, translation and degradation during oocyte maturation (By similarity). Probably promotes formation of some phase-separated membraneless compartment that stores maternal mRNAs in oocytes: ac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13695 zf-3CxxC 222 → 307 Zinc-binding domain Domain
Sequence 
MERFVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCI
DPYKRAQLKAILSQMNPSLSPRLCKPNTKEVGVQVSPRVDKAVQCSLGPRTLSSCSPWDG
RDPQEPLPACGVTSPATGRRGLIRLRRDGDEAESKALPGPAEASQPQPPSRRSGADRQEE
PGQLEESGEKDAPCPQETKSKQVPGDAASEPLRRPNFQFLEPKYGYFHCKDCKTRWESAY
VWCISGTNKVYFKQLCCKCQKSFNPYRVEAIQCQTCSKSHCSCPQKKRHIDLRRPHRQEL
CGRCKDKRFSCGNIYSFKYVM
Sequence length 321
Interactions View interactions