Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6464
Gene name Gene Name - the full gene name approved by the HGNC.
SHC adaptor protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SHC1
Synonyms (NCBI Gene) Gene synonyms aliases
SHC, SHCA
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016646 hsa-miR-429 Reporter assay 20005803
MIRT020350 hsa-miR-200a-3p Reporter assay 20005803
MIRT021079 hsa-miR-200c-3p Reporter assay 20005803
MIRT021650 hsa-miR-141-3p Reporter assay 20005803
MIRT023035 hsa-miR-124-3p Microarray 18668037
Transcription factors
Transcription factor Regulation Reference
SIRT1 Unknown 21778425
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IEA
GO:0001784 Function Phosphotyrosine residue binding IPI 20624904
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity IEA
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity TAS 1623525, 14676841
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600560 10840 ENSG00000160691
Protein
UniProt ID P29353
Protein name SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)
Protein function Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p46Shc and isoform p52Shc, once phosphorylated, couple activated recept
PDB 1MIL , 1N3H , 1OY2 , 1QG1 , 1SHC , 1TCE , 2L1C , 4JMH , 4XWX , 5CZI , 6DM4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00640 PID 162 318 Phosphotyrosine interaction domain (PTB/PID) Domain
PF00017 SH2 488 559 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in neural stem cells but absent in mature neurons.
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRN
PPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYH
MDNHLPIISAGSELCLQQPVERKL
Sequence length 583
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Relaxin signaling pathway
Growth hormone synthesis, secretion and action
Alcoholism
Bacterial invasion of epithelial cells
MicroRNAs in cancer
Glioma
Chronic myeloid leukemia
Breast cancer
Hepatocellular carcinoma
Gastric cancer
  Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
SHC1 events in ERBB2 signaling
SHC1 events in ERBB4 signaling
Signalling to RAS
SHC1 events in EGFR signaling
Tie2 Signaling
DAP12 signaling
SHC-related events triggered by IGF1R
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
Integrin signaling
XBP1(S) activates chaperone genes
Interleukin-3, Interleukin-5 and GM-CSF signaling
Constitutive Signaling by EGFRvIII
SHC-mediated cascade:FGFR1
SHC-mediated cascade:FGFR2
SHC-mediated cascade:FGFR3
SHC-mediated cascade:FGFR4
RAF/MAP kinase cascade
Signal attenuation
Insulin receptor signalling cascade
MET activates RAS signaling
RET signaling
Interleukin-15 signaling
Extra-nuclear estrogen signaling
Interleukin-2 signaling
Erythropoietin activates RAS
Interleukin receptor SHC signaling
Constitutive Signaling by Overexpressed ERBB2
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 ECD mutants
Signaling by ERBB2 TMD/JMD mutants
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Clear Cell Associate 24815386
Adenocarcinoma Mucinous Associate 24815386
Adenocarcinoma of Lung Associate 23815759, 34117717, 35421944, 36254009, 36311724, 37965333
Alzheimer Disease Associate 22788679, 37406134
Atherosclerosis Stimulate 16519809
Atherosclerosis Associate 20842738
Azoospermia Associate 39391879
Bone Diseases Associate 22740707
Breast Neoplasms Associate 16288304, 18611262, 21704603, 26976638, 29453318, 31759986
Breast Neoplasms Inhibit 39527598