Gene Gene information from NCBI Gene database.
Entrez ID 6464
Gene name SHC adaptor protein 1
Gene symbol SHC1
Synonyms (NCBI Gene)
SHCSHCA
Chromosome 1
Chromosome location 1q21.3
Summary This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen
miRNA miRNA information provided by mirtarbase database.
536
miRTarBase ID miRNA Experiments Reference
MIRT016646 hsa-miR-429 Reporter assay 20005803
MIRT020350 hsa-miR-200a-3p Reporter assay 20005803
MIRT021079 hsa-miR-200c-3p Reporter assay 20005803
MIRT021650 hsa-miR-141-3p Reporter assay 20005803
MIRT023035 hsa-miR-124-3p Microarray 18668037
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SIRT1 Unknown 21778425
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IEA
GO:0001784 Function Phosphotyrosine residue binding IPI 20624904
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity IEA
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity TAS 1623525, 14676841
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600560 10840 ENSG00000160691
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P29353
Protein name SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)
Protein function Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p46Shc and isoform p52Shc, once phosphorylated, couple activated recept
PDB 1MIL , 1N3H , 1OY2 , 1QG1 , 1SHC , 1TCE , 2L1C , 4JMH , 4XWX , 5CZI , 6DM4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00640 PID 162 318 Phosphotyrosine interaction domain (PTB/PID) Domain
PF00017 SH2 488 559 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in neural stem cells but absent in mature neurons.
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRN
PPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYH
MDNHLPIISAGSELCLQQPVERKL
Sequence length 583
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Relaxin signaling pathway
Growth hormone synthesis, secretion and action
Alcoholism
Bacterial invasion of epithelial cells
MicroRNAs in cancer
Glioma
Chronic myeloid leukemia
Breast cancer
Hepatocellular carcinoma
Gastric cancer
  Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
SHC1 events in ERBB2 signaling
SHC1 events in ERBB4 signaling
Signalling to RAS
SHC1 events in EGFR signaling
Tie2 Signaling
DAP12 signaling
SHC-related events triggered by IGF1R
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
Integrin signaling
XBP1(S) activates chaperone genes
Interleukin-3, Interleukin-5 and GM-CSF signaling
Constitutive Signaling by EGFRvIII
SHC-mediated cascade:FGFR1
SHC-mediated cascade:FGFR2
SHC-mediated cascade:FGFR3
SHC-mediated cascade:FGFR4
RAF/MAP kinase cascade
Signal attenuation
Insulin receptor signalling cascade
MET activates RAS signaling
RET signaling
Interleukin-15 signaling
Extra-nuclear estrogen signaling
Interleukin-2 signaling
Erythropoietin activates RAS
Interleukin receptor SHC signaling
Constitutive Signaling by Overexpressed ERBB2
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 ECD mutants
Signaling by ERBB2 TMD/JMD mutants