SHBG (sex hormone binding globulin)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID 6462
Gene name Sex hormone binding globulin
Gene symbol SHBG
Synonyms (NCBI Gene)
ABPSBPTEBG
Chromosome 17
Chromosome location 17p13.1
Summary This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, b
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT047620 hsa-miR-10a-5p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
HNF4A Activation 22210320
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005496 Function Steroid binding IBA
GO:0005496 Function Steroid binding IEA
GO:0005497 Function Androgen binding TAS 2587256
GO:0005515 Function Protein binding IPI 16143106
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
182205 10839 ENSG00000129214
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P04278
Protein name Sex hormone-binding globulin (SHBG) (Sex steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) (Testosterone-estradiol-binding globulin) (TeBG) (Testosterone-estrogen-binding globulin)
Protein function Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma me
PDB 1D2S , 1F5F , 1KDK , 1KDM , 1LHN , 1LHO , 1LHU , 1LHV , 1LHW , 6PYA , 6PYB , 6PYF , 6ULB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00054 Laminin_G_1 75 → 205 Laminin G domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 2 are present in liver and testis.
Sequence 
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDI
PQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL
VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTS
FCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Sequence length 402
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Sex Hormone-Binding Globulin Deficiency Uncertain significance rs138612626 RCV001175127
SHBG-related disorder Benign; Likely benign rs6259, rs758365968, rs543138281, rs566066937 RCV003966240
RCV003943954
RCV003942168
RCV003934308
Show/Hide Text Mining Associations (118)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Phase Reaction Associate 8540288
Adenocarcinoma Associate 26745061, 8989920, 9510475
Alzheimer Disease Stimulate 32699184
Amyotrophic Lateral Sclerosis Associate 32792518
Androgen Insensitivity Syndrome Associate 18719294, 32345305
Aortic Aneurysm Abdominal Associate 31413553
Arrest of spermatogenesis Associate 18980759
Arthritis Associate 32423484
Arthritis Juvenile Associate 31616008
Arthritis Rheumatoid Associate 32423484, 37644603