SHBG (sex hormone binding globulin)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6462
Gene name Gene Name - the full gene name approved by the HGNC.
Sex hormone binding globulin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SHBG
Synonyms (NCBI Gene) Gene synonyms aliases
ABP, SBP, TEBG
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, b
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT047620 hsa-miR-10a-5p CLASH 23622248
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
HNF4A Activation 22210320
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0005496 Function Steroid binding IBA
GO:0005496 Function Steroid binding IEA
GO:0005497 Function Androgen binding TAS 2587256
GO:0005515 Function Protein binding IPI 16143106
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
182205 10839 ENSG00000129214
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P04278
Protein name Sex hormone-binding globulin (SHBG) (Sex steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) (Testosterone-estradiol-binding globulin) (TeBG) (Testosterone-estrogen-binding globulin)
Protein function Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma me
PDB 1D2S , 1F5F , 1KDK , 1KDM , 1LHN , 1LHO , 1LHU , 1LHV , 1LHW , 6PYA , 6PYB , 6PYF , 6ULB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00054 Laminin_G_1 75 → 205 Laminin G domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 2 are present in liver and testis.
Sequence 
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDI
PQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL
VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTS
FCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Sequence length 402
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes (adjusted for BMI), Type 2 diabetes N/A N/A GWAS
Hypogonadism Hypogonadism N/A N/A GWAS
Show/Hide Text Mining Associations (118)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Phase Reaction Associate 8540288
Adenocarcinoma Associate 26745061, 8989920, 9510475
Alzheimer Disease Stimulate 32699184
Amyotrophic Lateral Sclerosis Associate 32792518
Androgen Insensitivity Syndrome Associate 18719294, 32345305
Aortic Aneurysm Abdominal Associate 31413553
Arrest of spermatogenesis Associate 18980759
Arthritis Associate 32423484
Arthritis Juvenile Associate 31616008
Arthritis Rheumatoid Associate 32423484, 37644603