RASSF10 (Ras association domain family member 10)

Gene

• Entrez ID: 644943
• Gene name: Ras association domain family member 10
• Gene symbol: RASSF10
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11p15.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1292618	hsa-miR-1202	CLIP-seq
MIRT1292619	hsa-miR-1290	CLIP-seq
MIRT1292620	hsa-miR-1825	CLIP-seq
MIRT1292621	hsa-miR-3714	CLIP-seq
MIRT1292622	hsa-miR-3972	CLIP-seq
MIRT1292623	hsa-miR-4307	CLIP-seq
MIRT1292624	hsa-miR-4475	CLIP-seq
MIRT1292625	hsa-miR-4524	CLIP-seq
MIRT1292626	hsa-miR-4733-5p	CLIP-seq
MIRT1292627	hsa-miR-4755-3p	CLIP-seq
MIRT1292628	hsa-miR-4776-3p	CLIP-seq
MIRT1292629	hsa-miR-548an	CLIP-seq
MIRT2086927	hsa-miR-4422	CLIP-seq
MIRT2457786	hsa-miR-3130-3p	CLIP-seq
MIRT2457787	hsa-miR-3194-3p	CLIP-seq
MIRT2457788	hsa-miR-3620	CLIP-seq
MIRT2457789	hsa-miR-4793-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	ISS

Other IDs

• MIM: 614713
• HGNC: 33984
• e!Ensembl: ENSG00000189431

Protein

• UniProt ID: A6NK89
• Protein name: Ras association domain-containing protein 10
• Protein function: Plays an important role in regulating embryonic neurogenesis.
• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain. Tends to be down-regulated in astrocytic gliomas due to promoter methylation. Methylation occurs early in gliomagenesis and the extent of methylation parallels with higher glioma grades, so that methylation is obser
• Sequence:

  MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRSRRLGSAGDPHG
  PGELPEPPNEDDEDDDEALPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGEE
  QENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCPARGAPARPSLAMTQEKQRRVVRKA
  FRKLAKLNRRRQQQTPSSCSSTSSSTASSCSSSPRTHESASVERMETLVHLVLSQDHTIR
  QQVQRLHELDREIDHYEAKVHLDRMRRHGVNYVQDTYLVGAGIELDGSRPGEEPEEVAAE
  AEEAAAAPPLAGEAQAAALEELARRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMR
  RRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQ
  QWDSKKRELQGLLQTLHTLELTVAPDGAPGSGSPSREPGPQACADMWVDQARGLAKSGPG
  NDEDSDTGLSSMHSQDSDSLPMCESLV

• Sequence length: 507

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUDITORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Basal Cell Nevus Syndrome	Associate	22113481	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	26645898	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	19934646	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Inhibit	32313718	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	29049167	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Inhibit	24759621	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	24759621	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Inhibit	35211758	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	31055025	★☆☆☆☆ Found in Text Mining only
Leukemia Biphenotypic Acute	Associate	19570220	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	22430796	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Inhibit	22430796	★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Associate	19570220	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	26945573, 29049167	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	22113481	★☆☆☆☆ Found in Text Mining only
Myopathies Structural Congenital	Associate	32313718	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	22113481, 35211758	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19570220, 24759621, 32313718	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	22113481, 22695170, 26945573, 29049167, 34224728, 35211758	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	22695170	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19570220	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Associate	19934646	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26945573, 31119967, 34224728	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	28268222	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Inhibit	19934646	★☆☆☆☆ Found in Text Mining only