SCG5 (secretogranin V)

Gene

• Entrez ID: 6447
• Gene name: Secretogranin V
• Gene symbol: SCG5
• Synonyms (NCBI Gene): 7B2, P7B2, SGNE1, SgV
• Chromosome: 15
• Chromosome location: 15q13.3
• Summary: This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the traffic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1329336	hsa-miR-1911	CLIP-seq
MIRT1329337	hsa-miR-3140-3p	CLIP-seq
MIRT1329338	hsa-miR-376a	CLIP-seq
MIRT1329339	hsa-miR-376b	CLIP-seq
MIRT1329340	hsa-miR-4268	CLIP-seq
MIRT1329341	hsa-miR-431	CLIP-seq
MIRT1329342	hsa-miR-526b	CLIP-seq
MIRT1329343	hsa-miR-653	CLIP-seq
MIRT2321887	hsa-miR-23a	CLIP-seq
MIRT2321888	hsa-miR-23b	CLIP-seq
MIRT2321889	hsa-miR-23c	CLIP-seq
MIRT2321890	hsa-miR-3678-3p	CLIP-seq
MIRT2321891	hsa-miR-4317	CLIP-seq
MIRT2458905	hsa-miR-139-5p	CLIP-seq
MIRT2458906	hsa-miR-2277-3p	CLIP-seq
MIRT2458907	hsa-miR-3160-5p	CLIP-seq
MIRT2458908	hsa-miR-499a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0004857	Function	Enzyme inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	7913882, 25416956, 32296183
GO:0005525	Function	GTP binding	TAS	3134253
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0016486	Process	Peptide hormone processing	IEA
GO:0016486	Process	Peptide hormone processing	ISS
GO:0030141	Component	Secretory granule	IEA
GO:0030141	Component	Secretory granule	ISS
GO:0030234	Function	Enzyme regulator activity	IBA
GO:0046883	Process	Regulation of hormone secretion	IBA
GO:0046883	Process	Regulation of hormone secretion	IEA
GO:0046883	Process	Regulation of hormone secretion	ISS
GO:0051082	Function	Unfolded protein binding	IDA	7913882

Other IDs

• MIM: 173120
• HGNC: 10816
• e!Ensembl: ENSG00000166922

Protein

• UniProt ID: P05408
• Protein name: Neuroendocrine protein 7B2 (Pituitary polypeptide) (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) [Cleaved into: N-terminal peptide; C-terminal peptide]
• Protein function: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secre
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05281	Secretogranin_V	21 → 161	Neuroendocrine protein 7B2 precursor (Secretogranin V)	Family

• Sequence:

  MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEY
  PAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPC
  PVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKR
  RSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

• Sequence length: 212

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Hereditary mixed polyposis syndrome	Uncertain significance	rs200799739	RCV000415665
Thyroid cancer, nonmedullary, 1	Likely benign	rs35500536	RCV005920788
Uterine corpus endometrial carcinoma	Likely benign	rs35500536	RCV005920789

Associations from Text Mining
Disease Name	Relationship Type	References
Amyotrophic Lateral Sclerosis	Associate	16313519
Colorectal Neoplasms	Associate	33976257
Glucose Intolerance	Associate	17617923
Insulin Resistance	Associate	17617923
Neoplasms	Associate	16293189, 35361846
Neuroblastoma	Associate	25811241
Obesity	Associate	17617923
Pancreatic Neoplasms	Associate	33164330
Squamous Cell Carcinoma of Head and Neck	Associate	33892811
Thyroid Neoplasms	Associate	27776138