Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64421
Gene name Gene Name - the full gene name approved by the HGNC.
DNA cross-link repair 1C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCLRE1C
Synonyms (NCBI Gene) Gene synonyms aliases
A-SCID, DCLREC1C, RS-SCID, SCIDA, SNM1C
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SCIDA
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein that is involved in V(D)J recombination and DNA repair. The encoded protein has single-strand-specific 5`-3` exonuclease activity; it also exhibits endonuclease activity on 5` and 3` overhangs and hairpins. The protein
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113870881 T>G Likely-benign, conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
rs121908156 G>A,T Pathogenic 5 prime UTR variant, synonymous variant, non coding transcript variant, coding sequence variant, stop gained, intron variant
rs121908157 G>A,T Pathogenic Stop gained, synonymous variant, non coding transcript variant, coding sequence variant
rs143782439 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Genic downstream transcript variant, synonymous variant, non coding transcript variant, coding sequence variant
rs146832860 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042846 hsa-miR-324-3p CLASH 23622248
MIRT508989 hsa-miR-410-3p HITS-CLIP 21572407
MIRT508988 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT515839 hsa-miR-4495 HITS-CLIP 21572407
MIRT508987 hsa-miR-190a-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000014 Function Single-stranded DNA endodeoxyribonuclease activity IDA 11955432
GO:0002250 Process Adaptive immune response IEA
GO:0003684 Function Damaged DNA binding IBA 21873635
GO:0004519 Function Endonuclease activity TAS
GO:0005515 Function Protein binding IPI 22529269, 23219551, 25941166
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605988 17642 ENSG00000152457
Protein
UniProt ID Q96SD1
Protein name Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein)
Protein function Nuclease involved in DNA non-homologous end joining (NHEJ); required for double-strand break repair and V(D)J recombination (PubMed:11336668, PubMed:11955432, PubMed:12055248, PubMed:14744996, PubMed:15071507, PubMed:15574326, PubMed:15936993).
PDB 3W1B , 3W1G , 4HTP , 6TT5 , 6WNL , 6WO0 , 7ABS , 7AF1 , 7AFS , 7AFU , 7AGI , 7APV , 7SGL , 7TYR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07522 DRMBL 239 345 DNA repair metallo-beta-lactamase Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in the kidney, lung, pancreas and placenta (at the mRNA level). Expression is not increased in thymus or bone marrow, sites of V(D)J recombination. {ECO:0000269|PubMed:11336668}.
Sequence
MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLY
CSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSV
MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSRE
ECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPE
ILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK
TNVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVG
TTMDKVVEILKPLCR
SSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTA
VSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQ
KADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQS
THITEQGSQGWDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKD
TYSDLKSRDKDVTIVPSTGEPTTLSSETHIPEEKSLLNLSTNADSQSSSDFEVPSTPEAE
LPKREHLQYLYEKLATGESIAVKKRKCSLLDT
Sequence length 692
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Non-homologous end-joining
Primary immunodeficiency
  Nonhomologous End-Joining (NHEJ)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Combined immunodeficiency Severe combined immunodeficiency with sensitivity to ionizing radiation rs121908717, rs121908714, rs121908716, rs199422327, rs121908715, rs121908739, rs121908740, rs121908723, rs387906267, rs121908735, rs121908721, rs1194494050, rs2123516908, rs587776534, rs199422328
View all (43 more)
11336668, 12592555, 12921762, 19953608, 12406895, 12569164, 12055248, 25917813, 21147755
Hypothyroidism Hypothyroidism rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912
View all (22 more)
Unknown
Disease term Disease name Evidence References Source
Otitis media Otitis Media ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 30947698
Cell Transformation Neoplastic Associate 25563294
Dyslipidemias Associate 30365130
Hyper IgM Immunodeficiency Syndrome Associate 26476407
Hypertension Associate 28562329
Immunologic Deficiency Syndromes Associate 25917813, 26476407
Inflammatory Bowel Diseases Associate 26476407
Leukemia Large Granular Lymphocytic Associate 24144642
Lymphoma Large B Cell Diffuse Associate 23960188
Neoplasms Associate 23960188