GLYCAM1 (glycosylation dependent cell adhesion molecule 1 (pseudogene))

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
644076
Gene name Gene Name - the full gene name approved by the HGNC.
Glycosylation dependent cell adhesion molecule 1 (pseudogene)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GLYCAM1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.2
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane TAS
GO:0050776 Process Regulation of immune response TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8IVK1
Protein name Putative glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in cells harvested from milk of lactating women. Not found in other tissues. {ECO:0000269|PubMed:12057858}.
Sequence 
MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP
Sequence length 47
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 16316942