GLYCAM1 (glycosylation dependent cell adhesion molecule 1 (pseudogene))

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 644076
Gene name Glycosylation dependent cell adhesion molecule 1 (pseudogene)
Gene symbol GLYCAM1
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IVK1
Protein name Putative glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in cells harvested from milk of lactating women. Not found in other tissues. {ECO:0000269|PubMed:12057858}.
Sequence 
MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP
Sequence length 47
Interactions View interactions