CDH22 (cadherin 22)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64405
Gene name Gene Name - the full gene name approved by the HGNC.
Cadherin 22
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDH22
Synonyms (NCBI Gene) Gene synonyms aliases
C20orf25, dJ998H6.1
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the cadherin superfamily. The gene product is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins. Expressed predominantly in the brain, this pu
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT440967 hsa-miR-412-3p HITS-CLIP 24374217
MIRT440967 hsa-miR-412-3p HITS-CLIP 24374217
MIRT879777 hsa-miR-3164 CLIP-seq
MIRT879778 hsa-miR-3616-5p CLIP-seq
MIRT879779 hsa-miR-3647-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005886 Component Plasma membrane IEA
GO:0005912 Component Adherens junction IBA
GO:0007043 Process Cell-cell junction assembly IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609920 13251 ENSG00000149654
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UJ99
Protein name Cadherin-22 (Pituitary and brain cadherin) (PB-cadherin)
Protein function Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. PB-cadherins may have a ro
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00028 Cadherin 67 → 159 Cadherin domain Domain
PF00028 Cadherin 173 → 268 Cadherin domain Domain
PF00028 Cadherin 282 → 386 Cadherin domain Domain
PF00028 Cadherin 400 → 490 Cadherin domain Domain
PF00028 Cadherin 503 → 600 Cadherin domain Domain
PF01049 Cadherin_C 648 → 819 Cadherin cytoplasmic region Family
Sequence 
MRPRPEGRGLRAGVALSPALLLLLLLPPPPTLLGRLWAAGTPSPSAPGARQDGALGAGRV
KRGWVWNQFFVVEEYTGTEPLYVGKIHSDSDEGDGAIKYTISGEGAGTIFLIDELTGDIH
AMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIGSVAEL
SPTGTSVMQVMASDADDPTYGSSARLVYSVLDGEHHFTVDPKTGVIRTAVPDLDRESQER
YEVVIQATDMAGQLGGLSGSTTVTIVVTDVNDNPPRFPQKMYQFSIQESAPIGTAVGRVK
AEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEA
LNKFVDPRFADLGTFRDQAIVRVAVTDVDEPPEFRPPSGLLEVQEDAQVGSLVGVVTARD
PDAANRPVRYAIDRESDLDQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEADNHAQL
SRASLRIRILDVNDNPPELATPYEAAVCEDAKPGQLIQTISVVDRDEPQGGHRFYFRLVP
EAPSNPHFSLLDIQDNTAAVHTQHVGFNRQEQDVFFLPILVVDSGPPTLSSTGTLTIRIC
GCDSSGTIQSCNTTAFVMAASLSPGALIALLVCVLILVVLVLLILTLRRHHKSHLSSDED
EDMRDNVIKYNDEGGGEQDTEAYDMSALRSLYDFGELKGGDGGGSAGGGAGGGSGGGAGS
PPQAHLPSERHSLPQGPPSPEPDFSVFRDFISRKVALADGDLSVPPYDAFQTYAFEGADS
PAASLSSLHSGSSGSEQDFAYLSSWGPRFRPLAALYAGHRGDDEAQAS
Sequence length 828
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Glioma Glioma N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 28149335
Colorectal Neoplasms Associate 28149335
Diabetes Mellitus Type 2 Associate 18602983
Hypoxia Stimulate 28991229
Kidney Failure Chronic Associate 18602983
Mucocutaneous Lymph Node Syndrome Associate 25101798
Neoplasm Metastasis Associate 28149335
Neoplasms Associate 28991229