Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64399
Gene name Gene Name - the full gene name approved by the HGNC.
Hedgehog interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HHIP
Synonyms (NCBI Gene) Gene synonyms aliases
HIP
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q31.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the hedgehog-interacting protein (HHIP) family. The hedgehog (HH) proteins are evolutionarily conserved protein, which are important morphogens for a wide range of developmental processes, including anteroposterior patterns o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT557338 hsa-miR-186-5p HITS-CLIP 21572407
MIRT557336 hsa-miR-6507-5p HITS-CLIP 21572407
MIRT557335 hsa-miR-4789-3p HITS-CLIP 21572407
MIRT557334 hsa-miR-511-3p HITS-CLIP 21572407
MIRT557333 hsa-miR-567 HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0005515 Function Protein binding IPI 19561609
GO:0005576 Component Extracellular region IEA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606178 14866 ENSG00000164161
Protein
UniProt ID Q96QV1
Protein name Hedgehog-interacting protein (HHIP) (HIP)
Protein function Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family.
PDB 2WFT , 2WFX , 2WG3 , 2WG4 , 3HO3 , 3HO4 , 3HO5 , 7PGK , 7PGL , 7PGM , 7PGN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03024 Folate_rec 38 220 Folate receptor family Domain
PF07995 GSDH 226 444 Glucose / Sorbosone dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed in fetal and adult tissues. Highest expression in adult heart, liver and pancreas, and in fetal kidney. {ECO:0000269|PubMed:11435703, ECO:0000269|Ref.1}.
Sequence
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQ
EVVSGLRQPVGALHSGDGSQ
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDI
NINLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Sequence length 700
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  cAMP signaling pathway
Hedgehog signaling pathway
Pathways in cancer
Basal cell carcinoma
  Ligand-receptor interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 30510241, 31089142
Colorectal cancer Colorectal Carcinoma, Adenocarcinoma of large intestine rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
30510241, 31089142
Colorectal neoplasms Colorectal Neoplasms, Malignant neoplasm of large intestine rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
30510241, 31089142
Gastrointestinal stromal tumor Gastrointestinal Stromal Tumors, Gastrointestinal Stromal Sarcoma rs587776653, rs74315368, rs74315369, rs587776793, rs587776794, rs587776795, rs606231209, rs121908589, rs121913685, rs121913680, rs794726675, rs587776804, rs121913517, rs121913234, rs121913512
View all (59 more)
27793025
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Osteoarthritis Of Hip Osteoarthritis Of Hip GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 17461467
Asthma Chronic Obstructive Pulmonary Disease Overlap Syndrome Associate 31631996
Carcinoma Adenoid Cystic Associate 26790448
Carcinoma Basal Cell Associate 11348463
Carcinoma Hepatocellular Associate 15373827, 36482325, 37120619, 8276102
Carcinoma Hepatocellular Inhibit 33277865
Carcinoma Mucoepidermoid Associate 26790448
Carcinoma Non Small Cell Lung Inhibit 31765425
Colorectal Neoplasms Associate 21339177
Colorectal Neoplasms Inhibit 37568084