Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6439
Gene name Gene Name - the full gene name approved by the HGNC.
Surfactant protein B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SFTPB
Synonyms (NCBI Gene) Gene synonyms aliases
PSP-B, SFTB3, SFTP3, SMDP1, SP-B
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% p
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35328240 G>TTC Pathogenic Coding sequence variant, frameshift variant
rs35373464 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs137853202 G>A Pathogenic Coding sequence variant, missense variant
rs779795223 ->TT Pathogenic Frameshift variant, coding sequence variant
rs1553380888 C>A Pathogenic Coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT716061 hsa-miR-7153-3p HITS-CLIP 19536157
MIRT716060 hsa-miR-4281 HITS-CLIP 19536157
MIRT716059 hsa-miR-5587-5p HITS-CLIP 19536157
MIRT716058 hsa-miR-133a-3p HITS-CLIP 19536157
MIRT508431 hsa-miR-4418 PAR-CLIP 23446348
Transcription factors
Transcription factor Regulation Reference
FOXA1 Activation 18003659
FOXM1 Activation 12161428
MYBBP1A Unknown 11274148
NF1 Unknown 7580940
NKX2-1 Activation 12161428;18003659;8065304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
178640 10801 ENSG00000168878
Protein
UniProt ID P07988
Protein name Pulmonary surfactant-associated protein B (SP-B) (18 kDa pulmonary-surfactant protein) (6 kDa protein) (Pulmonary surfactant-associated proteolipid SPL(Phe))
Protein function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per met
PDB 1DFW , 1KMR , 1RG3 , 1RG4 , 1SSZ , 2DWF , 2JOU , 2M0H , 2M1T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02199 SapA 30 61 Saposin A-type domain Family
PF05184 SapB_1 67 104 Saposin-like type B, region 1 Domain
PF03489 SapB_2 110 143 Saposin-like type B, region 2 Family
PF03489 SapB_2 333 366 Saposin-like type B, region 2 Family
Sequence
MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVW
G
HVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF
PLVIDYFQNQTDSNGICMHLGLC
KSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPV
LPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL
VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH
LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC
QALGVC
GTMSSPLQCIHSPDL
Sequence length 381
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Surfactant metabolism
Defective pro-SFTPB causes pulmonary surfactant metabolism dysfunction 1 (SMDP1) and respiratory distress syndrome (RDS)
Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5)
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary Pulmonary Alveolar Proteinosis hereditary pulmonary alveolar proteinosis rs35328240 N/A
Surfactant Metabolism Dysfunction, Pulmonary surfactant metabolism dysfunction, pulmonary, 1 rs35328240, rs1553380888, rs1558572491, rs779795223 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Lung Injury Associate 18950526
Adenocarcinoma Bronchiolo Alveolar Associate 26439040
Adenocarcinoma of Lung Associate 27322500, 35689561, 38001428
Alveolar capillary dysplasia Associate 10493923
Alveolitis Extrinsic Allergic Associate 35720392
Apraxia oculomotor Cogan type Associate 37890668
Autoimmune Diseases Associate 24098648
Bronchopulmonary Dysplasia Associate 10493923, 17264398, 23771654, 26045806
Carcinoma Large Cell Associate 27322500
Carcinoma Non Small Cell Lung Associate 12107845, 36203529