Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64388
Gene name	Gremlin 2, DAN family BMP antagonist
Gene symbol	GREM2
Synonyms (NCBI Gene)	CKTSF1B2DAND3PRDCSTHAG9
Chromosome	1
Chromosome location	1q43
Summary	This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene bel

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs373941682	G>A	Pathogenic	Coding sequence variant, missense variant
rs1057519288	C>A	Pathogenic	Missense variant, coding sequence variant

148

Show/Hide all (148)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029946	hsa-miR-26b-5p	Microarray	19088304
MIRT493733	hsa-miR-6087	PAR-CLIP	20371350
MIRT493732	hsa-miR-3960	PAR-CLIP	20371350
MIRT493730	hsa-miR-8072	PAR-CLIP	20371350
MIRT493731	hsa-miR-4467	PAR-CLIP	20371350
MIRT573040	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT573038	hsa-miR-4670-5p	PAR-CLIP	20371350
MIRT573039	hsa-miR-6072	PAR-CLIP	20371350
MIRT573037	hsa-miR-6891-3p	PAR-CLIP	20371350
MIRT573036	hsa-miR-3616-3p	PAR-CLIP	20371350
MIRT493733	hsa-miR-6087	PAR-CLIP	20371350
MIRT493732	hsa-miR-3960	PAR-CLIP	20371350
MIRT493730	hsa-miR-8072	PAR-CLIP	20371350
MIRT493731	hsa-miR-4467	PAR-CLIP	20371350
MIRT493735	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT493734	hsa-miR-500b-3p	PAR-CLIP	23592263
MIRT493733	hsa-miR-6087	PAR-CLIP	23592263
MIRT493732	hsa-miR-3960	PAR-CLIP	23592263
MIRT493730	hsa-miR-8072	PAR-CLIP	23592263
MIRT493731	hsa-miR-4467	PAR-CLIP	23592263
MIRT493732	hsa-miR-3960	PAR-CLIP	26701625
MIRT493732	hsa-miR-3960	PAR-CLIP	26701625
MIRT493732	hsa-miR-3960	PAR-CLIP	26701625
MIRT493732	hsa-miR-3960	PAR-CLIP	26701625
MIRT493731	hsa-miR-4467	PAR-CLIP	26701625
MIRT493731	hsa-miR-4467	PAR-CLIP	26701625
MIRT493731	hsa-miR-4467	PAR-CLIP	26701625
MIRT493731	hsa-miR-4467	PAR-CLIP	26701625
MIRT493734	hsa-miR-500b-3p	PAR-CLIP	26701625
MIRT493734	hsa-miR-500b-3p	PAR-CLIP	26701625
MIRT493733	hsa-miR-6087	PAR-CLIP	26701625
MIRT493733	hsa-miR-6087	PAR-CLIP	26701625
MIRT493735	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT493735	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT493730	hsa-miR-8072	PAR-CLIP	26701625
MIRT493730	hsa-miR-8072	PAR-CLIP	26701625
MIRT493730	hsa-miR-8072	PAR-CLIP	26701625
MIRT493730	hsa-miR-8072	PAR-CLIP	26701625
MIRT493733	hsa-miR-6087	PAR-CLIP	20371350
MIRT493732	hsa-miR-3960	PAR-CLIP	20371350
MIRT493730	hsa-miR-8072	PAR-CLIP	20371350
MIRT493731	hsa-miR-4467	PAR-CLIP	20371350
MIRT573040	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT573038	hsa-miR-4670-5p	PAR-CLIP	20371350
MIRT573039	hsa-miR-6072	PAR-CLIP	20371350
MIRT573037	hsa-miR-6891-3p	PAR-CLIP	20371350
MIRT573036	hsa-miR-3616-3p	PAR-CLIP	20371350
MIRT493733	hsa-miR-6087	PAR-CLIP	20371350
MIRT493732	hsa-miR-3960	PAR-CLIP	20371350
MIRT493730	hsa-miR-8072	PAR-CLIP	20371350
MIRT493731	hsa-miR-4467	PAR-CLIP	20371350
MIRT493735	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT493734	hsa-miR-500b-3p	PAR-CLIP	23592263
MIRT493733	hsa-miR-6087	PAR-CLIP	23592263
MIRT493732	hsa-miR-3960	PAR-CLIP	23592263
MIRT493730	hsa-miR-8072	PAR-CLIP	23592263
MIRT493731	hsa-miR-4467	PAR-CLIP	23592263
MIRT756333	hsa-miR-103a-3p	Luciferase reporter assayWestern blottingqRT-PCR	35619575
MIRT1033744	hsa-miR-1237	CLIP-seq
MIRT1033745	hsa-miR-1293	CLIP-seq
MIRT1033746	hsa-miR-3144-3p	CLIP-seq
MIRT1033747	hsa-miR-3174	CLIP-seq
MIRT1033748	hsa-miR-3183	CLIP-seq
MIRT1033749	hsa-miR-345	CLIP-seq
MIRT1033750	hsa-miR-3613-3p	CLIP-seq
MIRT1033751	hsa-miR-3614-3p	CLIP-seq
MIRT1033752	hsa-miR-365	CLIP-seq
MIRT1033753	hsa-miR-3692	CLIP-seq
MIRT1033754	hsa-miR-3921	CLIP-seq
MIRT1033755	hsa-miR-4424	CLIP-seq
MIRT1033756	hsa-miR-4436b-5p	CLIP-seq
MIRT1033757	hsa-miR-448	CLIP-seq
MIRT1033758	hsa-miR-4483	CLIP-seq
MIRT1033759	hsa-miR-4653-5p	CLIP-seq
MIRT1033760	hsa-miR-4705	CLIP-seq
MIRT1033761	hsa-miR-4723-3p	CLIP-seq
MIRT1033762	hsa-miR-4731-5p	CLIP-seq
MIRT1033763	hsa-miR-586	CLIP-seq
MIRT1033764	hsa-miR-607	CLIP-seq
MIRT1033765	hsa-miR-875-5p	CLIP-seq
MIRT1033766	hsa-miR-938	CLIP-seq
MIRT2006593	hsa-miR-3167	CLIP-seq
MIRT2006594	hsa-miR-3649	CLIP-seq
MIRT1033756	hsa-miR-4436b-5p	CLIP-seq
MIRT2006595	hsa-miR-4532	CLIP-seq
MIRT2006596	hsa-miR-4648	CLIP-seq
MIRT2006597	hsa-miR-4660	CLIP-seq
MIRT2006598	hsa-miR-545	CLIP-seq
MIRT2006599	hsa-miR-548p	CLIP-seq
MIRT2006600	hsa-miR-552	CLIP-seq
MIRT2006601	hsa-miR-876-5p	CLIP-seq
MIRT2239001	hsa-miR-3912	CLIP-seq
MIRT1033754	hsa-miR-3921	CLIP-seq
MIRT2239002	hsa-miR-3977	CLIP-seq
MIRT2239003	hsa-miR-4436b-3p	CLIP-seq
MIRT2239004	hsa-miR-4473	CLIP-seq
MIRT2239005	hsa-miR-4539	CLIP-seq
MIRT1033759	hsa-miR-4653-5p	CLIP-seq
MIRT2239006	hsa-miR-512-3p	CLIP-seq
MIRT2239007	hsa-miR-520f	CLIP-seq
MIRT2388755	hsa-miR-4297	CLIP-seq
MIRT2388756	hsa-miR-4327	CLIP-seq
MIRT2450753	hsa-miR-3185	CLIP-seq
MIRT2450754	hsa-miR-3915	CLIP-seq
MIRT2450755	hsa-miR-3928	CLIP-seq
MIRT2543006	hsa-miR-105	CLIP-seq
MIRT2543007	hsa-miR-1182	CLIP-seq
MIRT2543008	hsa-miR-1251	CLIP-seq
MIRT2543009	hsa-miR-136	CLIP-seq
MIRT2543010	hsa-miR-2467-3p	CLIP-seq
MIRT2543011	hsa-miR-342-3p	CLIP-seq
MIRT1033749	hsa-miR-345	CLIP-seq
MIRT2543012	hsa-miR-34b	CLIP-seq
MIRT2543013	hsa-miR-34c-3p	CLIP-seq
MIRT2543014	hsa-miR-3678-3p	CLIP-seq
MIRT1033753	hsa-miR-3692	CLIP-seq
MIRT2543015	hsa-miR-4252	CLIP-seq
MIRT2543016	hsa-miR-4286	CLIP-seq
MIRT2388756	hsa-miR-4327	CLIP-seq
MIRT2543017	hsa-miR-4687-5p	CLIP-seq
MIRT2543018	hsa-miR-4768-5p	CLIP-seq
MIRT2543019	hsa-miR-4777-5p	CLIP-seq
MIRT2543020	hsa-miR-483-3p	CLIP-seq
MIRT2543021	hsa-miR-548c-3p	CLIP-seq
MIRT2543022	hsa-miR-593	CLIP-seq
MIRT2543023	hsa-miR-627	CLIP-seq
MIRT2543024	hsa-miR-873	CLIP-seq
MIRT2543025	hsa-miR-924	CLIP-seq
MIRT2543026	hsa-miR-942	CLIP-seq
MIRT2543006	hsa-miR-105	CLIP-seq
MIRT2543008	hsa-miR-1251	CLIP-seq
MIRT2543009	hsa-miR-136	CLIP-seq
MIRT1033749	hsa-miR-345	CLIP-seq
MIRT2543012	hsa-miR-34b	CLIP-seq
MIRT2543013	hsa-miR-34c-3p	CLIP-seq
MIRT1033753	hsa-miR-3692	CLIP-seq
MIRT2543015	hsa-miR-4252	CLIP-seq
MIRT2543016	hsa-miR-4286	CLIP-seq
MIRT2543017	hsa-miR-4687-5p	CLIP-seq
MIRT2543018	hsa-miR-4768-5p	CLIP-seq
MIRT2543019	hsa-miR-4777-5p	CLIP-seq
MIRT2543020	hsa-miR-483-3p	CLIP-seq
MIRT2543021	hsa-miR-548c-3p	CLIP-seq
MIRT2543022	hsa-miR-593	CLIP-seq
MIRT2543023	hsa-miR-627	CLIP-seq
MIRT2543024	hsa-miR-873	CLIP-seq
MIRT2543025	hsa-miR-924	CLIP-seq
MIRT2543026	hsa-miR-942	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS
GO:0010172	Process	Embryonic body morphogenesis	IEA
GO:0010172	Process	Embryonic body morphogenesis	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0036122	Function	BMP binding	IBA
GO:0036122	Function	BMP binding	IEA
GO:0038098	Process	Sequestering of BMP from receptor via BMP binding	IBA
GO:0038098	Process	Sequestering of BMP from receptor via BMP binding	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0048018	Function	Receptor ligand activity	IBA
GO:0048263	Process	Determination of dorsal identity	IEA
GO:0060300	Process	Regulation of cytokine activity	ISS

MIM	HGNC	e!Ensembl
608832	17655	ENSG00000180875

Q9H772

Protein name

Gremlin-2 (Cysteine knot superfamily 1, BMP antagonist 2) (DAN domain family member 3) (Protein related to DAN and cerberus)

Protein function

Cytokine that inhibits the activity of BMP2 and BMP4 in a dose-dependent manner, and thereby modulates signaling by BMP family members. Contributes to the regulation of embryonic morphogenesis via BMP family members. Antagonizes BMP4-induced sup

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03045	DAN	50 → 160	DAN domain	Domain

Sequence

MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ

Sequence length

168

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway		Signaling by BMP

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Tooth agenesis, selective, 9	Pathogenic	rs1057519288	RCV000415615

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
GREM2-related disorder	Likely benign	rs752063931	RCV003952240

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	34477243
Alzheimer Disease	Associate	22710270
Blister	Associate	35008956
Bohring syndrome	Associate	39614348
Carcinoma Renal Cell	Associate	35945780
Colorectal Neoplasms	Associate	35619575
Meningioma	Inhibit	31039818
Meningioma	Associate	38446374
Neoplasms Squamous Cell	Associate	34477137
Osteoporosis	Associate	32297643
Osteoporotic Fractures	Associate	32297643
Ovarian Diseases	Associate	37033258
Pancreatic Neoplasms	Associate	36990335
Triple Negative Breast Neoplasms	Associate	33299869

GREM2 (gremlin 2, DAN family BMP antagonist)