Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64377
Gene name Gene Name - the full gene name approved by the HGNC.	Carbohydrate sulfotransferase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHST8
Synonyms (NCBI Gene) Gene synonyms aliases	GALNAC4ST1, GalNAc4ST, PSS3
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylg

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017236	hsa-miR-335-5p	Microarray	18185580
MIRT892634	hsa-miR-149	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892636	hsa-miR-331-3p	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT1964563	hsa-miR-3157-5p	CLIP-seq
MIRT1964564	hsa-miR-4287	CLIP-seq
MIRT1964565	hsa-miR-4469	CLIP-seq
MIRT1964566	hsa-miR-4492	CLIP-seq
MIRT1964567	hsa-miR-4498	CLIP-seq
MIRT1964568	hsa-miR-4505	CLIP-seq
MIRT1964569	hsa-miR-4685-3p	CLIP-seq
MIRT1964570	hsa-miR-4691-3p	CLIP-seq
MIRT1964571	hsa-miR-4731-5p	CLIP-seq
MIRT1964572	hsa-miR-615-5p	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT1964573	hsa-miR-762	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT2200726	hsa-miR-3605-5p	CLIP-seq
MIRT2200727	hsa-miR-4459	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IDA	10988300, 11001942, 11445554
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IEA
GO:0001537	Function	Dermatan 4-sulfotransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005794	Component	Golgi apparatus	IEA
GO:0006790	Process	Sulfur compound metabolic process	IDA	11445554
GO:0007417	Process	Central nervous system development	NAS	10988300
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10988300
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0030166	Process	Proteoglycan biosynthetic process	IDA	10988300
GO:0030166	Process	Proteoglycan biosynthetic process	IEA
GO:0042446	Process	Hormone biosynthetic process	IEP	10988300

MIM	HGNC	e!Ensembl
610190	15993	ENSG00000124302

Protein

UniProt ID

Q9H2A9

Protein name

Carbohydrate sulfotransferase 8 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 1) (GalNAc-4-ST1) (GalNAc4ST-1) (N-acetylgalactosamine-4-O-sulfotransferase 1)

Protein function

Catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Required for biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of their

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03567	Sulfotransfer_2	182 → 417	Sulfotransferase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in pituitary gland. In brain, it is expressed in pituitary gland, cerebellum, medulla oblongata, pons, thalamus and spinal cord. Expressed in the epidermis. Expressed at lower level in lung, spleen, adrenal glan

Sequence

MTLRPGTMRLACMFSSILLFGAAGLLLFISLQDPTELAPQQVPGIKFNIRPRQPHHDLPP
GGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMP
AAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQERKRVMQEACAKYRASSSRRAVTPRH
VSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFD
RQGILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREAL
RTGSGVRFPEFVQYLLDVHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFLS
LIRAPRNLTFPRFKDRHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDYLMFNYSKPF
ADLY

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	Various types of N-glycan biosynthesis Metabolic pathways		Reactions specific to the complex N-glycan synthesis pathway

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Endometriosis	Endometriosis	N/A	N/A	GWAS
Peeling Skin Syndrome	peeling skin syndrome type A	N/A	N/A	GenCC

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Asthma	Associate	20816195
Ehlers Danlos Syndrome musculocontractural type 1	Associate	20004762
Peeling Skin Syndrome	Associate	22289416

CHST8 (carbohydrate sulfotransferase 8)