CHST8 (carbohydrate sulfotransferase 8)

Gene

• Entrez ID: 64377
• Gene name: Carbohydrate sulfotransferase 8
• Gene symbol: CHST8
• Synonyms (NCBI Gene): GALNAC4ST1, GalNAc4ST, PSS3
• Chromosome: 19
• Chromosome location: 19q13.11
• Summary: The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylg

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017236	hsa-miR-335-5p	Microarray	18185580
MIRT892634	hsa-miR-149	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892636	hsa-miR-331-3p	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT1964563	hsa-miR-3157-5p	CLIP-seq
MIRT1964564	hsa-miR-4287	CLIP-seq
MIRT1964565	hsa-miR-4469	CLIP-seq
MIRT1964566	hsa-miR-4492	CLIP-seq
MIRT1964567	hsa-miR-4498	CLIP-seq
MIRT1964568	hsa-miR-4505	CLIP-seq
MIRT1964569	hsa-miR-4685-3p	CLIP-seq
MIRT1964570	hsa-miR-4691-3p	CLIP-seq
MIRT1964571	hsa-miR-4731-5p	CLIP-seq
MIRT1964572	hsa-miR-615-5p	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT1964573	hsa-miR-762	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT2200726	hsa-miR-3605-5p	CLIP-seq
MIRT2200727	hsa-miR-4459	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IDA	10988300, 11001942, 11445554
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IEA
GO:0001537	Function	Dermatan 4-sulfotransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005794	Component	Golgi apparatus	IEA
GO:0006790	Process	Sulfur compound metabolic process	IDA	11445554
GO:0007417	Process	Central nervous system development	NAS	10988300
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10988300
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0030166	Process	Proteoglycan biosynthetic process	IDA	10988300
GO:0030166	Process	Proteoglycan biosynthetic process	IEA
GO:0042446	Process	Hormone biosynthetic process	IEP	10988300

Other IDs

• MIM: 610190
• HGNC: 15993
• e!Ensembl: ENSG00000124302

Protein

• UniProt ID: Q9H2A9
• Protein name: Carbohydrate sulfotransferase 8 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 1) (GalNAc-4-ST1) (GalNAc4ST-1) (N-acetylgalactosamine-4-O-sulfotransferase 1)
• Protein function: Catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Required for biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of their
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03567	Sulfotransfer_2	182 → 417	Sulfotransferase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in pituitary gland. In brain, it is expressed in pituitary gland, cerebellum, medulla oblongata, pons, thalamus and spinal cord. Expressed in the epidermis. Expressed at lower level in lung, spleen, adrenal glan
• Sequence:

  MTLRPGTMRLACMFSSILLFGAAGLLLFISLQDPTELAPQQVPGIKFNIRPRQPHHDLPP
  GGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMP
  AAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQERKRVMQEACAKYRASSSRRAVTPRH
  VSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFD
  RQGILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREAL
  RTGSGVRFPEFVQYLLDVHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFLS
  LIRAPRNLTFPRFKDRHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDYLMFNYSKPF
  ADLY

• Sequence length: 424

Pathways

KEGG:

Various types of N-glycan biosynthesis
Metabolic pathways

Reactome:

Reactions specific to the complex N-glycan synthesis pathway

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
CHST8-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign	rs149660944, rs57474890, rs768636087, rs758685180	RCV003917553 RCV003929725 RCV003911958 RCV003944252 RCV003915852
Peeling skin syndrome type A	Conflicting classifications of pathogenicity	rs149660944	RCV000162277

Associations from Text Mining
Disease Name	Relationship Type	References
Asthma	Associate	20816195
Ehlers Danlos Syndrome musculocontractural type 1	Associate	20004762
Peeling Skin Syndrome	Associate	22289416