Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64377
Gene name Gene Name - the full gene name approved by the HGNC.
Carbohydrate sulfotransferase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHST8
Synonyms (NCBI Gene) Gene synonyms aliases
GALNAC4ST1, GalNAc4ST, PSS3
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylg
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017236 hsa-miR-335-5p Microarray 18185580
MIRT892634 hsa-miR-149 CLIP-seq
MIRT892635 hsa-miR-218 CLIP-seq
MIRT892636 hsa-miR-331-3p CLIP-seq
MIRT892637 hsa-miR-636 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0001537 Function Dermatan 4-sulfotransferase activity IDA 10988300, 11001942, 11445554
GO:0001537 Function Dermatan 4-sulfotransferase activity IEA
GO:0001537 Function Dermatan 4-sulfotransferase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610190 15993 ENSG00000124302
Protein
UniProt ID Q9H2A9
Protein name Carbohydrate sulfotransferase 8 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 1) (GalNAc-4-ST1) (GalNAc4ST-1) (N-acetylgalactosamine-4-O-sulfotransferase 1)
Protein function Catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Required for biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of their
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03567 Sulfotransfer_2 182 417 Sulfotransferase family Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in pituitary gland. In brain, it is expressed in pituitary gland, cerebellum, medulla oblongata, pons, thalamus and spinal cord. Expressed in the epidermis. Expressed at lower level in lung, spleen, adrenal glan
Sequence
MTLRPGTMRLACMFSSILLFGAAGLLLFISLQDPTELAPQQVPGIKFNIRPRQPHHDLPP
GGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMP
AAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQERKRVMQEACAKYRASSSRRAVTPRH
VSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFD
RQGILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREAL
RTGSGVRFPEFVQYLLDVHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFLS
LIRAPRNLTFPRFKDRHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDYLMFNYS
KPF
ADLY
Sequence length 424
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Various types of N-glycan biosynthesis
Metabolic pathways
  Reactions specific to the complex N-glycan synthesis pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Endometriosis Endometriosis N/A N/A GWAS
Peeling Skin Syndrome peeling skin syndrome type A N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 20816195
Ehlers Danlos Syndrome musculocontractural type 1 Associate 20004762
Peeling Skin Syndrome Associate 22289416