Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64376
Gene name Gene Name - the full gene name approved by the HGNC.
IKAROS family zinc finger 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IKZF5
Synonyms (NCBI Gene) Gene synonyms aliases
PEGASUS, THC7, ZNFN1A5
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.13
Summary Summary of gene provided in NCBI Entrez Gene.
Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM, Jul 2002]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050501 hsa-miR-20a-5p CLASH 23622248
MIRT036641 hsa-miR-935 CLASH 23622248
MIRT657189 hsa-miR-6074 HITS-CLIP 23824327
MIRT657188 hsa-miR-362-5p HITS-CLIP 23824327
MIRT657187 hsa-miR-500b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10978333
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 10978333
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IDA 10978333
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606238 14283 ENSG00000095574
Protein
UniProt ID Q9H5V7
Protein name Zinc finger protein Pegasus (Ikaros family zinc finger protein 5)
Protein function Transcriptional repressor that binds the core 5'GNNTGTNG-3' DNA consensus sequence (PubMed:10978333, PubMed:31217188). Involved in megakaryocyte differentiation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, skeletal muscle, kidney, and liver. Expressed in the hematopoietic cell lines MOLT-4, NALM-6 and K-562. Highly expressed in THP-1 and M-07e cell lines, which have characteristics of myeloid and early megakary
Sequence
MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVE
VSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASA
YERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWG
VLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLP
RDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCPDEKPFMIQQPSTQAVVSAV
SASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPALPVQDP
QLLHHCQHCDMYFADNILYTIHMGCHGYENPFQCNICGCKCKNKYDFACHFARGQHNQH
Sequence length 419
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Thrombocytopenia thrombocytopenia 7 N/A N/A GenCC
Thrombocytopenia With Normal Platelets autosomal thrombocytopenia with normal platelets N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Developmental Disabilities Associate 32419556
Immunologic Deficiency Syndromes Associate 32419556
Thrombasthenia Thrombocytopenia Hereditary Associate 32419556
Thrombocytopenia Associate 32419556
Tomaculous neuropathy Associate 32419556