Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64375
Gene name Gene Name - the full gene name approved by the HGNC.
IKAROS family zinc finger 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IKZF4
Synonyms (NCBI Gene) Gene synonyms aliases
EOS, ZNFN1A4
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM, Jul 2002]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020311 hsa-miR-130b-3p Sequencing 20371350
MIRT028174 hsa-miR-93-5p Sequencing 20371350
MIRT051190 hsa-miR-16-5p CLASH 23622248
MIRT049855 hsa-miR-32-5p CLASH 23622248
MIRT047855 hsa-miR-30c-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0003700 Function DNA-binding transcription factor activity IBA 21873635
GO:0003700 Function DNA-binding transcription factor activity TAS 10978333
GO:0005515 Function Protein binding IPI 15491138, 32296183
GO:0005634 Component Nucleus TAS 10978333
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606239 13179 ENSG00000123411
Protein
UniProt ID Q9H2S9
Protein name Zinc finger protein Eos (Ikaros family zinc finger protein 4)
Protein function DNA-binding protein that binds to the 5'GGGAATRCC-3' Ikaros-binding sequence. Transcriptional repressor. Interacts with SPI1 and MITF to repress transcription of the CTSK and ACP5 promoters via recruitment of corepressors SIN3A and CTBP2. May be
PDB 2MA7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 187 209 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 215 237 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 248 271 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in skeletal muscle, low levels of expression in heart, thymus, kidney, liver, and spleen. Expressed in the hematopoietic cell lines MOLT-4, NALM-6 and K-562. Highly expressed in THP-1 and M-07e cell lines, which have c
Sequence
MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCE
SSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLL
EKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRS
HTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVS
SPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPD
SMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELV
AHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSRE
AGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQ
PPPTIVVGRHSPAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFL
DHVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIVRGEHKVG
Sequence length 585
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
18198356, 21829393
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 21804548 ClinVar, GWAS
Vitiligo Vitiligo GWAS
Alopecia Areata Alopecia Areata GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alopecia Areata Associate 20596022, 38330583
Asthma Associate 35524249
Diabetes Mellitus Type 1 Associate 28597949, 34448034
Narcolepsy Associate 37188663
Obesity Associate 35524249
Polycystic Ovary Syndrome Associate 33664499
Sveinsson Chorioretinal Atrophy Associate 38330583
Vitiligo Associate 22951725